3BZ6


Conserved Protein Domain Family
DUF480

?
pfam04337: DUF480 
Click on image for an interactive view with Cn3D
Protein of unknown function, DUF480
This family consists of several proteins of uncharacterized function.
Statistics
?
PSSM-Id: 398160
Aligned: 94 rows
Threshold Bit Score: 188.059
Threshold Setting Gi: 283475114
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BZ6_A                  24 STEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVXNLTQGQVGQSLRALEGRGLTRLV---XGSRADRWEHKV 100 Pseud...
WP_012936785             5 AVEIRVLGCLIEKQRTTPDAYPLSLNALRLACNQSTNRDPVMQYDEAVIRDALQHLYRRGWTRLTs-gHGSRAAKYRHLL 83  Conex...
WP_011756222             9 AEEQRVLGSLLEKQRTVPDSYPLTLNSLRTACNQSSSREPVVDYDEHTVEQVGRRLKDRGLLRIVwsdTGRRTLKYHQVL 88  uncla...
BAK33216                 4 PVEQRVLGALLEKQRTVPDSYPLSLNGLRTACNQSTSRDPVVAYDEATILDALNRLRDRELVRFVk-pTGLRVVKYHQRL 82  Micro...
jgi:Trad_2009            5 PVAVRVLGALLEKAHTTPENYPLSLNALVLACNQKTSRDPVTAYSERDVEEALQGLRDRGLVSSSq-gVSERVVKHQHRL 83  Truep...
PRJNA194094:J421_2254    7 AEEVRVLGSLVEKQITTPDNYPLSMSALVAACNQTSNRDPVMRLDEDGVMRAIVPLRRRGLMRAIq-pSGSRVTKYEVLL 85  Gemma...
B5E8F0                   7 GTELRVLGSLVEKDLTTPEYYPLSLNALVNACNQKSNRDPVLSLDESQVTRALDTLRFKQYALVSg--SGGRVAKYRHAL 84  Geoba...
pacbio:K649_09950        6 EAEVRVLGTLIEKQYATPDHYPLTENAVRLGANQKNNRQPVTNLSEAEVREALDALQRKRLCGMFr-eYNARAPKYRQFL 84  Meiot...
PRJNA63271:OPIT5_06635  38 PLEARALGCLIEKELTTPDVYPLTLNSLVNACNQRNNRAPVLTVSASEVEAALEGLRQKRLAALFa-gADARVPKFRQTL 116 Opitu...
WP_013044455            14 EAEARVLGCLLEKAVTTPDVYPLTFNSLLTACNQKTNRDPVVDYDEDVVAEAIEGLRGKQLIYRAd-gAGSRVQKYRHRI 92  Coral...
3BZ6_A                 101 DKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRXH-DFEDSEQVVHQLERLIARg---lATLVPRQSGQ 166 Pseudomonas syr...
WP_012936785            84 DEALHLAPDELALLAVLMLRGAQTPGELKQRSDRLH-HFDDLGAVQTTLDRLIERd---hVARLARRPGQ 149 Conexibacter wo...
WP_011756222            89 DEVLDLAEDERALVTVLLLRGPQAPGELKTRTERLH-GFADRGAVEQTLSRMAERg---lVRELPRRGGd 154 unclassified No...
BAK33216                83 EEQLGLDAPAAALVSVLMLRGAQTAGELRPRTERLH-PFADREAVEGSLRALAAMdp-plVHELERQAGQ 150 Microlunatus ph...
jgi:Trad_2009           84 EEALSLSRPDLAVLAVLMLRGPQTAGELRSRTERYT-HFPDVAAVEASLRRLAEHrp-plARAEARAPGQ 151 Truepera radiov...
PRJNA194094:J421_2254   86 RDALNLDARELAVLAVLMLRGAQTAGELNARTARLA-EFADLADVETTLAALAARepeplVVRLPRSAGR 154 Gemmatirosa kal...
B5E8F0                  85 VEKFRFSPAELAILCELMLRGPQTVGELRGRGERMH-KFSDLSEVESVLADLAERtp-slVAKLPLQPGR 152 Geobacter bemid...
pacbio:K649_09950       85 DREFKLEPPATILMALLMLRGPQTLGELRARAESMNhKFASLQEVEAVLKELINLaphplVAPLERQPGE 154 Meiothermus rub...
PRJNA63271:OPIT5_06635 117 DLVYPLETAARAVLAELLLRGPQTTAELRTRAARMHpPLSGADEVESLLADMAARpagplVRRLPRQPGQ 186 Opitutaceae bac...
WP_013044455            93 DERFGLSAASQALLTVLLLRGPQTPGELRTRTERMH-VFLDVAAVEAEIAATAEDvdlplWTRLPQAPGQ 161 Coraliomargarit...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap