2FEC,3ND0


Conserved Protein Domain Family
Voltage_CLC

?
pfam00654: Voltage_CLC 
Click on image for an interactive view with Cn3D
Voltage gated chloride channel
This family of ion channels contains 10 or 12 transmembrane helices. Each protein forms a single pore. It has been shown that some members of this family form homodimers. In terms of primary structure, they are unrelated to known cation channels or other types of anion channels. Three ClC subfamilies are found in animals. ClC-1 is involved in setting and restoring the resting membrane potential of skeletal muscle, while other channels play important parts in solute concentration mechanisms in the kidney. These proteins contain two pfam00571 domains.
Statistics
?
PSSM-Id: 425802
Aligned: 105 rows
Threshold Bit Score: 92.6109
Created: 16-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FEC_B          89 LAMFGYFLVRKYa---PEA-GG--S--GIPEIEGALEDQRPVRWWRVLPVK-------FFGGLGTLGGGMVLGREGPTVQ 153 Escherichia coli
Q5L974          76 GIFLAGWFVRNIvkddISH--------GVTKILYAISRRQGRI-------KrhniwssTIASAITIGFGGSVGAEAPIVL 140 Bacteroides f...
jgi:Hore_11720  35 GGFITSIIIYTg----SKAaKG--H--GIPAILETIESNKYGLSSRDLLVE-------GLASAITIGSGGSAGRIGPVVE 99  Halothermothr...
Q39PZ5         108 GATIMLPLFIWYredmAF---------GFPRFLERVNLRGGRLPLRLMFTR-------GISSALTIGSGGSAGQEGPIAQ 171 Geobacter met...
Q9HPN8         248 GGLIVGLVIRRTt---TAI-RG--H--GVPEVLESLMVHNGQIDPKIAVYK-------TVSSSIAIASGASLGREGPIVQ 312 Halobacterium...
jgi:Rmet_0584  119 GGLIVGLMARYGsdkiRGH--------GIPEAIEAVLFGKSKMSPKVAVLK-------PLSSGIVIGSGGPFGAEGPIIM 183 Cupriavidus m...
Q316N5         106 GGLAVGYLVSRFa---REA-RG--H--GVPEVMEAIALHDGRIRKRVALVK-------IFASAISISSGGSVGREGPIVQ 170 Desulfovibrio...
Q6AIP2          77 GGLLVGPLILLa----KEA-KG--H--GVPEVMQALVLRGGRIRGRVAAAK-------IVASAICIGTGGSAGREGPIIQ 140 Desulfotalea ...
Q8GX93         136 GGLVVSILNQLResagKSTgDShsSldRVKAVLRPF------L-------K-------TVAACVTLGTGNSLGPEGPSVE 195 thale cress
Q2RU61          79 GGLLVGLYYAKVmpggKPQ--------GVAQVIGAVARTGGRMRAGDGVLA-------ACGSALSLGCGASVGREGPAVH 143 Rhodospirillu...
2FEC_B         154 IGGNIGRMVldifrlkgDEARHTLLATGAAAGLAAAFNAPLAGILFIIE-QMRPqfRYTLIS------IKAVFIGVIMST 226 Escherichia coli
Q5L974         141 TGSAIGSNLgsmf-kmeHRTLMLLVGCGAAGAIGGIFKAPIAGLVFTLE-VLMI--DLTMSS------LLPLLISAVTAA 210 Bacteroides f...
jgi:Hore_11720 100 IGAGLGDIAgrkl-nmpLGTYQTLLGCGAAAGIAAIFNAPLGGIMFAVE-VLYT--NLEIKR------LSLIVISAISAD 169 Halothermothr...
Q39PZ5         172 IGGTAGSVVghll-gmpEERLKVLIGCGVSGGVAATFNAPLAGVFFAHEiVLLS--SFELSS------FTSIVISSGMAT 242 Geobacter met...
Q9HPN8         313 IGSAAGSYFgaf---vhSRYTRTLVAAGAGSGIAATFNTPLAGVMFALE-ILLS--EYALTN------VVTVVLSAVTAT 380 Halobacterium...
jgi:Rmet_0584  184 TGGSIASLLaqyl-hltAAERKTLLVSGACAGMTAIFGTPVAAVLLAIE-LLLF--ELRPRS------LLPVALACAVAG 253 Cupriavidus m...
Q316N5         171 IGSGIGSTVgqml-kvgRPQRRTLVGCGAAAGIAATFNAPVAGVLFALE-LLLG--DFGLAA------FSPVVLSSVVAT 240 Desulfovibrio...
Q6AIP2         141 VGAAFGSSLgqil-klsDERIRNLVACGAAAGIAATFNAPIAGVVFAIE-VLMF--NIHIRA------FGNVVISSVAAS 210 Desulfotalea ...
Q8GX93         196 IGASIAKGVnslf-nksPQTGFSLLAAGSAAGISSGFNAAVAGCFFAVEsVLWPs-SSTDSStslpntTSMVILSAVTAS 273 thale cress
Q2RU61         144 LGAALAAGLagrl-rlgPGLARTVLGCGVAAAVAASFNAPIAGALFAGE-VVIG--HYALSA------FAPIVVSSVVAT 213 Rhodospirillu...
2FEC_B         227 IMYRIFNHEVAL-----IDVGkls--daPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHrv---hGGNITKWVLMgg 296 Escherichia coli
Q5L974         211 TVSYITTGQEAMf---kFHLDqp----fELERIPYVILLGIFCGLVSLYFTRAMNSVEGVFGk-----lSNPYKKLAL-- 276 Bacteroides f...
jgi:Hore_11720 170 AIVRNISGYNPIfdlppFQLN-------HPLEYIFYIILGILLGIFSNLFIKGLYMVTNLFNn----lKINYHLKPII-- 236 Halothermothr...
Q39PZ5         243 VVSRAMYGDIPAfdvpaYQLV-------HPLELVLYALLGIVCGCVAALFITGYGKTREFFEq----lRVNPLWKPLL-- 309 Geobacter met...
Q9HPN8         381 AVARSVLAFTAVpgvreFLVPityhivtPSLEFPLYAGLGVVAAGIGAAVVRLLYASEHLFQdr---wDLPGYLTPAI-- 455 Halobacterium...
jgi:Rmet_0584  254 FLRPFVFEAGPL-----FPLQta---paSTLALGSCVLAGLLCGALGAGLTLALYRTEDAFDh----lRLHWMWWPAI-- 319 Cupriavidus m...
Q316N5         241 TISRHYFGDFPAfvvpgYEVA-------SLWEYGIYPFLGIVCGAVAVIFVTVLYRTEDLCEa----vRLPDPLKACL-- 307 Desulfovibrio...
Q6AIP2         211 IVSRLFLGHGAAfavptYTMA-------NPVELVLYFILGLTAALVGVFFIRILDVAETVFDn----wDFPQIFKPAV-- 277 Desulfotalea ...
Q8GX93         274 VVSEIGLGSEPAfkvpdYDFR-------SPGELPLYLLLGALCGLVSLALSRCTSSMTSAVDslnkdaGIPKAVFPVM-- 344 thale cress
Q2RU61         214 VLSRGWFGDFPAfilphLTLA-------SAWEFPAFVVLGGLCGLVAVAFMRGVFLAGGLASa----lRLPVVLRPMV-- 280 Rhodospirillu...
2FEC_B         297 aIGGLCGLLGFVA-----------------------PA---TSGGGFNLIPIATAGNF-------------------SMG 331 Escherichia coli
Q5L974         277 -GGVMLSVLIFLF-----------------------PP---LYGEGYDTIELLLNGVSnadwdtvlnnslfygygnlLLV 329 Bacteroides f...
jgi:Hore_11720 237 -GGLFVGLTGFFI-----------------------PR---VLGTGIPVISKAFTKSY-------------------LFN 270 Halothermothr...
Q39PZ5         310 -GGFLAGCVGVLL-----------------------PQ---VQGNGYGFIEKAVGNDV-------------------GWL 343 Geobacter met...
Q9HPN8         456 -GGALLGVSVLLTavlld--------------asplQSatwLFGVGYGTIHSSIAGDLt-----------------lLV- 502 Halobacterium...
jgi:Rmet_0584  320 -GGLVVGIGGYFE-----------------------PR---ALGVGYDVIGDLLNNRL-------------------LVE 353 Cupriavidus m...
Q316N5         308 -GGAAVGCMLLWF-----------------------PH---VFGVGYGGINLALQNGL-------------------GWQ 341 Desulfovibrio...
Q6AIP2         278 -GAACLGVIGLIYmsfpgfvdpnatgvhgpitaapiPH---MFGTGFPFIGYALQGKG-------------------SFW 334 Desulfotalea ...
Q8GX93         345 -GGLSVGIIALVY-----------------------PE---VLYWGFQNVDILLEKRPfvk--------------glSAD 383 thale cress
Q2RU61         281 -AGALVGLLALVL-----------------------PE---VLGVGYEATDQVLKGAY-------------------HLD 314 Rhodospirillu...
2FEC_B         332 MLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVEL-FPQYh--------lEAGTFAIAGMGALLAASI 402 Escherichia coli
Q5L974         330 YLVLIILLKVFASSATNGGGGCGGIFAPSLYLGCIAGFVFSHFSNDFdFTSt---------lPEKNFALMGMAGVMSGVM 400 Bacteroides f...
jgi:Hore_11720 271 TLIILAILKIVATCLTLGSGGSGGIFAPGLLVGASTGLFCGGFLNTY-LPGIv--------tSPESYGIVGMAAFISGII 341 Halothermothr...
Q39PZ5         344 LVTLLIVGKMAATCVTIGSGLPGGTFAPSLFIGSVTGMSFGFLANLL-FPLHt--------aTPGAYALVGMGAFLASVT 414 Geobacter met...
Q9HPN8         503 -LVALAVLKVVGFSLSIGSGNSGGVFSPTLYVGAMAGGAFGVLVNAA-FAGt---------aSAGAYALVGTAGVFAATA 571 Halobacterium...
jgi:Rmet_0584  354 AAVALLAVKAVIWIAALGSGTSGGVLAPLLMLGAGLGVVLAPMLPg---------------gSPGLWALVCMAGVLGSVL 418 Cupriavidus m...
Q316N5         342 MMLLLVGVKIIATSVTIGSGGSGGVFAPSLFIGSMTGGFFGWAAGQL-FPGIt--------aLPGAYALVAMGGLVAGTT 412 Desulfovibrio...
Q6AIP2         335 VLLMLVFLKPLATTFTLGSGNSGGVFAPSLFTGAMLGGAMGHVFLYF-FPGIt--------gNIGAYALVGMAALFSATA 405 Desulfotalea ...
Q8GX93         384 LLLQLVAVKIAATAWCRASGLVGGYYAPSLFIGGAAGMAYGKFIGLAlAQNPdfnlsilevaSPQAYGLVGMAATLAGVC 463 thale cress
Q2RU61         315 LLLPLILAKLAASVICLGFGFGGGVFSPSLTLGALVGGAFGLAIALV-APv----------sASGAYALIGMGALSAAVL 383 Rhodospirillu...
2FEC_B         403 RAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQ 437 Escherichia coli
Q5L974         401 HAPLTGVFLIAELTGGYDLFLPLMIVSVSSYLTII 435 Bacteroides fragilis NCTC 9343
jgi:Hore_11720 342 RAPLTAVLIIFELTGNYSLILPLLLGAVLASNISK 376 Halothermothrix orenii H 168
Q39PZ5         415 HAPMTGIFLLFEMTGSYKVIIPIMLACSIGTAVAR 449 Geobacter metallireducens GS-15
Q9HPN8         572 SAPLTATLIIFELTGQYTIILPLLAVTVIGSEVAQ 606 Halobacterium salinarum
jgi:Rmet_0584  419 GAPLTAIVFAFGLTHDSEALLPLLLTTAVAYGFSV 453 Cupriavidus metallidurans CH34
Q316N5         413 HAPITAILIIFELTGDYQIILPLMVTCILATVTAS 447 Desulfovibrio alaskensis G20
Q6AIP2         406 RAPLTAMLIVFEMSGDYEMILPLMIAGVTACYVAQ 440 Desulfotalea psychrophila
Q8GX93         464 QVPLTAVLLLFELTQDYRIVLPLLGAVGMSSWITS 498 thale cress
Q2RU61         384 GAPISTTLIVFELTGDYALSVGTMVAAVVAGALSR 418 Rhodospirillum rubrum ATCC 11170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap