Conserved Protein Domain Family
Mito_carr

?
pfam00153: Mito_carr 
Click on image for an interactive view with Cn3D
Mitochondrial carrier protein
Statistics
?
PSSM-Id: 278578
View PSSM: pfam00153
Aligned: 161 rows
Threshold Bit Score: 55.3551
Threshold Setting Gi: 74676440
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2C3E_A         3 QALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHAS-KQisaek--------qykgIIDCVVRIPKEQGF-LSFWRG 72
gi 1723690    12 QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANgLKpfg------------sqVMEVARSMIKNEGI-RSFWKG 78
gi 332278178 276 K---AQSSLLTAVLSAGIATLTCYPLDTVRRQMQMRGTPyKS-----------------IPEAFAGIIDRDGL-IGLYRG 334
gi 75218987  240 NELTVVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKdASaivtgegrstasleytgMVDAFRKTVRHEGF-GALYKG 318
gi 13124065  438 SEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITrYSpqp------------dtMFGQFKYILQNEGV-TGFYRG 504
gi 75018735  201 V-ENSYYRMLFGMLAGLIGQSSSYPLDIVRRRMQTGRIPsGWs----------------PLRALIHIYHTEGLkRGLYKG 263
gi 150416122 222 RQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTgYPra--------------sIARTLRTIVREEGAvRGLYKG 287
gi 74963772   54 YKFYPMALCSSWTIRCML-----YPMSVVKSRLQLQRQNnVYn---------------gMRDAFVKIIRQEGI-GALYKG 112
gi 74676440  113 PRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNySS-----------------LKEAITHIYTKEGL-FGFFRG 174
gi 392901138  11 EPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPiRGkksg---------kykgVMQSIFLITREEGA-HAFWKG 80
                         90       100       110
                 ....*....|....*....|....*....|
2C3E_A        73 NLANVIRYFPTQALNFAFKDKYKQIFLGGV 102
gi 1723690    79 NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG 108
gi 332278178 335 FLPNALKTLPNSSIRLTTFDMVKRLIATSE 364
gi 75218987  319 LVPNSVKVVPSIAIAFVTYEMVKDVLGVEF 348
gi 13124065  505 ITPNFLKVIPAVSISYVVYEKVRTGLGVPV 534
gi 75018735  264 LSMNWLKGPIAVGVSFTTYEKVLELV-GHL 292
gi 150416122 288 LSMNWVKGPIAVGISFTTFDLMQILL-RHL 316
gi 74963772  113 FWMTLPQLS-ASFLYSSAYERVRDLLQTHL 141
gi 74676440  175 FGATCLRDAPYAGLYVLLYEKSKQLLPMVL 204
gi 392901138  81 HIPAQGLSATYGLVQFSSFE----WLSQQA 106
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap