Conserved Protein Domain Family
Homeobox

?
pfam00046: Homeobox 
Click on image for an interactive view with Cn3D
Homeobox domain
Statistics
?
PSSM-Id: 306543
View PSSM: pfam00046
Aligned: 157 rows
Threshold Bit Score: 44.7985
Threshold Setting Gi: 75334130
Created: 11-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
1ZQ3_P          5 TRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHK 58
gi 485956425  222 PRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMK 275
gi 1708829    163 PRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEK 216
gi 82189343   181 PRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKER 234
gi 62288356   217 PRTTIRQNQLDVLNEMFSNTPKPSKHARAKLALETGLSMRVIQVWFQNRRSKER 270
gi 8247936    269 MRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFR 322
gi 341940899  222 ARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHK 275
gi 62510367   151 VRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQK 204
gi 74966354   214 TKSPFTEHEIAVMMALFEINKSPNHEEVQKLAVQLNLGYRSVANFFMNKRAKER 267
gi 48429221  2157 NRTRFTDYQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVWFQNARQKQR 2210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap