2NPN


Conserved Protein Domain Family
CobF

?
TIGR02434: CobF 
Click on image for an interactive view with Cn3D
precorrin-6A synthase (deacetylating)
In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively. This model identifies CobF in High GC gram positive, alphaproteobacteria and pseudomonas-related species.
Statistics
?
PSSM-Id: 131487
View PSSM: TIGR02434
Aligned: 9 rows
Threshold Bit Score: 371.72
Threshold Setting Gi: 50840973
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NPN_A         3 RTIYVIGIGTGSPEFLTLQAISGLRHAQAIVALDKGEQKSDLLALRQKIVD-----THAPGTPIYAVTDPER--DRNPDN 75  Corynebacterium...
CAB89032       2 RTIHVIGIGAGDPEQLTLQAVRALRGTDVFFVLDKGEAKSDLVRLRRDMLEa---hVPEGTYRVAEARDPERdrSAGGAA 78  Streptomyces co...
AAN69357       2 KDLLLIGIGAGDPRQVTYEAVDALRSASVFFVLDKGDDKDELVRLRKAILQr---yRPEGGYRLVPVVDPLR--DAQAQD 76  Pseudomonas put...
P21636         7 RKILIIGIGSGNPEHMTVQAINALNCADVLFIPTKGAKKTELAEVRRDICAr---yVTRKDSRTVEFAVPVR--RTEGVS 81  Pseudomonas den...
CAE27538       2 RKILLIGIGPGGPNYLTFQAVEALNRATVFFIPDKGDEKAELRLAREQICEr---fITAPGYRFVTIDIPKR--EAQPQD 76  Rhodopseudomona...
BAC48540       2 LALSLIGIGCGDPEQLTHAATRAINAADLVLIPRKGSAKSDLADLRRTICAd---vLTSDNTRIAEFDLPVR--DAGEAD 76  Bradyrhizobium ...
CAE49338       2 RTIYVIGIGTGSPEFLTLQAISGLRHAQAIVALDKGEQKSDLLALRQKIVD-----THAPGTPIYAVTDPER--DRNPDN 74  Corynebacterium...
WP_015632687   3 RHIHVIGIGAGDPDYLTVQAIEALNDTQVFFAMDKGEQKSDLVALRREICSr---fIRQPGYRFVELRDPKR--SDRAD- 76  Mycobacterium a...
AAT83640       3 RRLDLIGIGPGNPDWLTLAAVDAIQHLDVLFVVLKEHDVDDLVEFRREVLRrhrpdADFDGLHIVELQDPPRp-WKTAEN 81  Propionibacteri...
2NPN_A        76 YEEEVRRWHAERAHLLASTIRERTPDDGAVAFLVWGDPSLYDSTLRIIEHXRN----LEDLHADVKVIPGITAVQVLTAE 151 Corynebacterium...
CAB89032      79 YSPAVGDWRSARAGIYERLIAEELGEDETGAFLVWGDPALYDSTLGILEEILE----RGSVAFEYDVVPGISSVSSLVAR 154 Streptomyces co...
AAN69357      77 YLGAVQNWHRQRAALYARLIEEEIGDGETGAFLLWGEPTLYDSTLRILDLVRE----QGVT-LRLQVIPGISSVQALAAR 151 Pseudomonas put...
P21636        82 YDGSVDDWHAQIAGIYEALLSKELGEEGTGAFLVWGDPMLYDSTIRIVERVKA----RGEVAFAYDVIPGITSLQALCAS 157 Pseudomonas den...
CAE27538      77 YRATVDDWHARIADRFAQAMTEQLPEGSCGAFLVWGDPSLYDSTIRILDRLR-----LRGMEIDYEIIPGITAVQALTAR 151 Rhodopseudomona...
BAC48540      77 YRKGVDDWHDAVAAKWSQTITSHLEGDGRVALLIWGDPSLYDSSLRIAGRLDP-------LP-EIEVIPGITSIQALCAA 148 Bradyrhizobium ...
CAE49338      75 YEEEVRRWHAERAHLLASTIRERTPDDGAVAFLVWGDPSLYDSTLRIIEHMRN----LEDLHADVKVIPGITAVQVLTAE 150 Corynebacterium...
WP_015632687  77 YRDAVAEWHAARAQIWADAIAAELGPHGVGGFLAWGDPSLYDSTLRILDTVAG----HVEFTFDV--IPGITAVQALTAR 150 Mycobacterium a...
AAT83640      82 YKAAVAKWRRQRLDQWTHAVADNLADGERGGFLVWGDPGLFESTLAIVKKLIAavdaDGGVPIELNVIPGISSSLSLASR 161 Propionibacteri...
2NPN_A       152 HGILINRIGEAIHITTGRNLPETsAKDR-RNCVVXLDGKTAWQDVATEHTYXWWGAFLGTEQQVLRKGYVHEIGAQVAEL 230 Corynebacterium...
CAB89032     155 HRTGLNRVARPVQITTGRRLAEG-FPEDaDDVVVMLDAHQAFRRYADQDIDIYWGAYLGTPDEILDSGPIAEAAPRIERL 233 Streptomyces co...
AAN69357     152 HQVPLNRIGEPLTVLPGRRLAEQg--Av-DNVVVMLDGQCAFAGLDDPALTIYWGAYLGTEDEVLIAGPLQAVKAQILEV 228 Pseudomonas put...
P21636       158 HRIPLNLVGKPVEITTGRRLHES-FPEKsQTSVVMLDGEQAFQRVEDPEAEIYWGAYLGTRDEIVISGRVAEVKDRILET 236 Pseudomonas den...
CAE27538     152 HGIALNGIGEPVTVTTGRKLAATgRWSG-ETMVVMLDGEETFAKIDAEGAEIFWAANLGMDDEVLVTGKLPEIAPEIQRI 230 Rhodopseudomona...
BAC48540     149 HALPLNDIGEPFLVTTGRRLREGgWPVSaDTVVVMLDGGTAFQSLDPVGLQIWWGAYLGMPDQIIMSGALAEVGPRIAAL 228 Bradyrhizobium ...
CAE49338     151 HGILINRIGEAIHITTGRNLPETsAKDR-RNCVVMLDGKTAWQDVATEHTYMWWGAFLGTEQQVLRKGYVHEIGAQVAEL 229 Corynebacterium...
WP_015632687 151 HRIPLNEVGEPVLITTGRQLRAHgISG---SAVVMLDADCSFQRCAPETR-IWWGAYLGTADELLVAGTVGEVGPRIAAL 226 Mycobacterium a...
AAT83640     162 HQIPLNRQGRALQISPARLLANG-MPEGvDDVIVMLDGRQTFSLIDPTDIDIYWAAYIGTPDEILISGDLAEVREEIRSA 240 Propionibacteri...
2NPN_A       231 KQQLRTEHGWIXDTYLLRE 249 Corynebacterium diphtheriae
CAB89032     234 RAEARERKGWIMDTYLLRR 252 Streptomyces coelicolor A3(2)
AAN69357     229 RERERARKGWIMDTYLLRR 247 Pseudomonas putida KT2440
P21636       237 RAAARAKMGWIMDIYLLRK 255 Pseudomonas denitrificans
CAE27538     231 RRQVRAAKGWVMDIYLLRK 249 Rhodopseudomonas palustris CGA009
BAC48540     229 RQEARERHGWIMDCYILKR 247 Bradyrhizobium diazoefficiens USDA 110
CAE49338     230 KQQLRTEHGWIMDTYLLRE 248 Corynebacterium diphtheriae
WP_015632687 227 RAQARARHGWIMDTYLLRP 245 Mycobacterium avium
AAT83640     241 RADAEKRLGWVFDTYLLRR 259 Propionibacterium acnes KPA171202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap