Conserved Protein Domain Family
two_anch

?
TIGR02226: two_anch 
N-terminal double-transmembrane domain
This model represents a prokaryotic N-terminal region of about 80 amino acids. The predicted membrane topology by TMHMM puts the N-terminus outside and spans the membrane twice, with a cytosolic region of about 25 amino acids between the two transmembrane regions. Member proteins tend to be between 600 and 1000 amino acids in length. [Hypothetical proteins, Domain]
Statistics
?
PSSM-Id: 131281
View PSSM: TIGR02226
Aligned: 12 rows
Threshold Bit Score: 47.3425
Threshold Setting Gi: 13424436
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD74809       1 MNFLNLGLLAGALAFVVPLAIHLLFRSRYRSMD--WGAMFLLQDVVAKNRRRMQWHQWILLALRCAIPILLALAMARPLL 78   Rhodopirellula...
CAD76999       1 MTFFNATLILGTLAAVVPIALHLLARREPQRVV--FPGVRFLRPKLSSQRSRLRIRRWWLLALRVLAVIALAVALARPHI 78   Rhodopirellula...
CAD71619       1 MSFLSVAFLFALPLVAAPLLLHLFDRRRNETVQ--WGAMQFLMEASARKTSSRKLKQWLLLLLRCLAIAALIFALARPLL 78   Rhodopirellula...
CAD76032       1 MSFLQPWMLFALPIALLPILIHLINQRRYQTTQ--WAAMMFLLAANRMNRGYARIRQWAILALRTLVLLALIIAIGRPLA 78   Rhodopirellula...
CAD78504       1 MSMLAPFFLAGALAVAAPILFHLIRQHPKGAVP--FSSVMFLREVPPRLTRRSRLDQWPLLLLRALALLLLAAAFARPFL 78   Rhodopirellula...
AAM39408       2 MLLLFPAGLAALAALVLPLLIHLARRSEHRPTD--FAALRWLRALP-RPRHRVRFDEWPLLLVRLVLLAALAVLLAEPAL 78   Xanthomonas ca...
AAK24792       3 PALLLPAALAALLAVAVPLAIHIARRTETKTID--FAALRWLNPNP-KPVQRLQLDERLLLAVRIALIVAIAIALARPLL 79   Caulobacter cr...
BAB49792       6 LSFGAPMVLWGLLA--LPVIWWLLRLTPPKPQAeiFPPLKILARVLKREETPHQ-SPWWLTLLRLLMAGLIVAALAEPVF 82   Mesorhizobium ...
tigr:BR1558    6 LAFGSPLILAGLIA--LPVIWWLLRMTPPRPQEetFPPLRILAQVFRREEVPSK-SPWWMTLLRLLIAGLVILALASPIW 82   Brucella suis ...
CAE26626       7 LSFAQPLLLIGLLA--LPALWWLLRVMPPRPRRvdFPPTRLLFEIAPKEETPSR-TPWWLTALRMLAAALVIIALAGPIW 83   Rhodopseudomon...
WP_019565199   6 FVFTSPYILFGLLA--LPAIWWLLRLTPPRPKAevFPPLKILATVLKREETPSK-SPWWLTLLRIALAAAVIFALADPVV 82   Agrobacterium ...
WP_011556538   1 MTFGNPWMLLGALGALIPLLVHLFDRRRPRPHP--FGPLAFVMRSQKRTASRLKLKRLLLYALRTLILLAIPIALARPEL 78   Myxococcus xan...
CAD74809      79 SSAR 82   Rhodopirellula baltica SH 1
CAD76999      79 DSSL 82   Rhodopirellula baltica SH 1
CAD71619      79 PTGY 82   Rhodopirellula baltica SH 1
CAD76032      79 SGSL 82   Rhodopirellula baltica SH 1
CAD78504      79 RGAD 82   Rhodopirellula baltica SH 1
AAM39408      79 RDHD 82   Xanthomonas campestris pv. campestris str. ATCC 33913
AAK24792      80 RPSG 83   Caulobacter crescentus CB15
BAB49792      83 NPRE 86   Mesorhizobium loti MAFF303099
tigr:BR1558   83 NPRP 86   Brucella suis 1330
CAE26626      84 NPQT 87   Rhodopseudomonas palustris CGA009
WP_019565199  83 NPRN 86   Agrobacterium sp. 10MFCol1.1
WP_011556538  79 TRDA 82   Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap