1IZL


Conserved Protein Domain Family
psbD

?
TIGR01152: psbD 
Click on image for an interactive view with Cn3D
Photosystem II, DII subunit (also called Q(A))
This model describes the Photosystem II, DII subunit (also called Q(A)) in bacterial and its equivalents in chloroplast of algae and higher plants. Photosystem II is in many ways functionally equivalent to bacterial reaction center. At the core of Photosystem II are several light harvesting cofactors including plastoquinones, pheophytins, phyloquinones etc. These cofactors are intimately associated with the polypeptides, which principally including subunits DI, DII, Cyt.b, Cyt.f and iron-sulphur protein. Together they participate in the electron transfer reactions that lead to the net production of the reducting equivalents in the form of NADPH, which are used for reduction of CO2 to carbohydrates(C6H1206). Phosystem II operates during oxygenic photosynthesis and principal electron donor is H2O. Although no high resolution X-ray structural data is presently available, recently a 3D structure of the supercomplex has been described by cryo-electron microscopy. Besides a huge body of literature exits that describes function using a variety of biochemical and biophysical techniques. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130222
View PSSM: TIGR01152
Aligned: 21 rows
Threshold Bit Score: 686.25
Threshold Setting Gi: 400884
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IZL_D   1 MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST 80  Thermosynechococcus e...
P06007   1 MTIAIGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYTHGLATSYLEGCNFLTAAVST 80  Chlamydomonas reinhar...
P31557   1 MTFTDLNTENKNGWFDVADDWLKKDRFIFIGWSGLLLFPCSYLALGGWLTGITFVTSWYTHGLASSFLEGCNALTAAVST 80  Euglena gracilis
P48079   1 MTVAIGRSDSERGWFDVLDDWLKRDRFVFLGWSGLLLLPCAYLAVGAWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVST 80  Cyanophora paradoxa
P09192   1 MTIAVGRAPVERGWFDVLDDWLKRDRFVFIGWSGLLLFPCAFMALGGWLTGTTFVTSWYTHGLASSYLEGANFLTVAVSS 80  Synechocystis sp. PCC...
P20898   1 MTIAVGRAPQERGWFDVLDDWLKRDRFVFVGWSGILLFPCAFMALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSS 80  Synechococcus sp. PCC...
P11005   1 MTIAVGRAPAERGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYLALGGWLTGTSFVTSWYTHGIASSYLEGGNFLTVAVST 80  Synechococcus elongat...
P51766   1 MTTAVGRIS-DRGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYMAIGGWLTGTTFATSWYTHGIASSYLEGCNFLTVAIST 79  Prochlorothrix hollan...
P49478   1 MTIAIGQNQ-ERGLFDLIDDWLKKDRFVFIGWSGLLLFPTAYLAAGGWMTGTTFVTSWYTHGLASSYLEGCNFLTAAVST 79  Odontella sinensis
P51357   1 MTIAIGQEK-TRGGFDLVDDWLKRDRFVFVGWSGLLLFPCAYLAVGGWLTGTTFVTSWYTHGLASSYLEGCNFLTAAVST 79  Porphyra purpurea
1IZL_D  81 PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY 160 Thermosynechococcus e...
P06007  81 PANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIY 160 Chlamydomonas reinhar...
P31557  81 PPNSMGHSLLLLLGSEAQWDFTRWLQIGGLWPFIALHGAFGLIGFMLRQFEIAKAVQIRPYNAIAFSAPISVFVSVFLIY 160 Euglena gracilis
P48079  81 PANSMGHSILFVWGPEAQGDFTRWCQIGGLWTFTALHGALGLIGFTLRQFEIARLIGLRPYNAIAFSGPIAVFVSVFLLY 160 Cyanophora paradoxa
P09192  81 PADAFGHSLLFLWGPEAQGNLTRWFQIGGLWPFVALHGAFGLIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLMY 160 Synechocystis sp. PCC...
P20898  81 PADSLGHSLLFLWGPEANWNFARWCQLGGLWSFVALHGAFGLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMY 160 Synechococcus sp. PCC...
P11005  81 PADAFGHSLMLLWGPEAQGNFVRWCQLGGLWNFVALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSGPIAVFVSVFLMY 160 Synechococcus elongat...
P51766  80 PADSMGHALLLLWGPEAQGAFVRWVQLGGLWTFTALHGAFALIGFMLRQFEIARLVGVRPYNAIAFSAPIALFVSVFLIY 159 Prochlorothrix hollan...
P49478  80 PANSMGHSLLLLWGPEAQGDFTRWCQIGGLWAFIALHGAFGLIGFCLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLLY 159 Odontella sinensis
P51357  80 PANSMGHSLLFLWGPEAQGDFTRWCQIGGLWAFIALHGSFGLIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLMY 159 Porphyra purpurea
1IZL_D 161 PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA 240 Thermosynechococcus e...
P06007 161 PLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA 240 Chlamydomonas reinhar...
P31557 161 PLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDSPNTFRAFNPLQS 240 Euglena gracilis
P48079 161 PLGQAGWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGSNTFPAFNPTQA 240 Cyanophora paradoxa
P09192 161 PLGQSSWFFAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEDSNTFRAFEPTQA 240 Synechocystis sp. PCC...
P20898 161 PLGQSSWFFAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSDQANTFRAFEPTQA 240 Synechococcus sp. PCC...
P11005 161 PLGQSSWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSEQSNTFRAFEPTQA 240 Synechococcus elongat...
P51766 160 PLGQSSWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGDDATTFRGFEPTQS 239 Prochlorothrix hollan...
P49478 160 PLGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGDAANTFRAFTPTQS 239 Odontella sinensis
P51357 160 PLGQASWFFAPSLGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVQNTLFEDGDAADTFRAFTPTQS 239 Porphyra purpurea
1IZL_D 241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL 320 Thermosynechococcus e...
P06007 241 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNIL 320 Chlamydomonas reinhar...
P31557 241 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMVFVPVTGLRMSALGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNIL 320 Euglena gracilis
P48079 241 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLGVNLRAYDFVSQEIRAAEDPEFETFYTKNLL 320 Cyanophora paradoxa
P09192 241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 320 Synechocystis sp. PCC...
P20898 241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNIL 320 Synechococcus sp. PCC...
P11005 241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 320 Synechococcus elongat...
P51766 240 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWMSAIGVVGLALNLRSYDFVSQEIRAAEDPEFETFYTKNIL 319 Prochlorothrix hollan...
P49478 240 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 319 Odontella sinensis
P51357 240 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAFGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 319 Porphyra purpurea
1IZL_D 321 LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 352 Thermosynechococcus elongatus BP-1
P06007 321 LNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL 352 Chlamydomonas reinhardtii
P31557 321 LNEGIRAWMAAQDQPHEQFIFPEEVLPRGNAL 352 Euglena gracilis
P48079 321 LNEGIRAWMAVQDQPHENFVFSEEVLPRGNAL 352 Cyanophora paradoxa
P09192 321 LNEGMRAWMAPQDQPHENFIFPEEVLPRGNAL 352 Synechocystis sp. PCC 6803 substr. Kazusa
P20898 321 LNEGMRAWMAPQDQIHEQFVFPEEVLPRGNAL 352 Synechococcus sp. PCC 7002
P11005 321 LNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL 352 Synechococcus elongatus PCC 7942
P51766 320 LNEGLRAWMAPQDQPHENFIFPEEVLPRGNAL 351 Prochlorothrix hollandica
P49478 320 LNEGIRAWMAAQDQPHENFVFPEEVLPRGNAL 351 Odontella sinensis
P51357 320 LNEGIRSWMAAQDQPHENFIFPEEVLPRGNAL 351 Porphyra purpurea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap