2UUV


Conserved Protein Domain Family
FAD-oxidase_C

?
pfam02913: FAD-oxidase_C 
Click on image for an interactive view with Cn3D
FAD linked oxidases, C-terminal domain
This domain has a ferredoxin-like fold.
Statistics
?
PSSM-Id: 397178
Aligned: 47 rows
Threshold Bit Score: 135.135
Threshold Setting Gi: 145322176
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UUV_A   314 VPQAVEYYGFLFPTFAHAVSALQQIRSSe-vIPTMIRVYDPEETQLSFAWKPSKgavseftsa-mvkkylhyiRSFDFKN 391 Dictyostelium disco...
Q9EQR2   370 TPEYQKYGSVAFPNFEQGVACLREIAKQr-cAPASIRLMDNQQFQFGHALKPQVssiftsfldgfkkfyitkfKGFDPNQ 448 Norway rat
Q9V778   337 LPSLRRYGSLAFPNFEQGVLFMREVARRr-cQPASVRLMDNEQFMFGQALKPEKswwasvvda-mkqryvtswKGIDLNQ 414 fruit fly
O45218   313 IPEVKRFGSFVFPNFESGVNFFREVAIQr-cQPASLRLMDNDQFVMGQALKVASdswwadlkssvskmyitswKGFKVDE 391 Caenorhabditis elegans
Q585R0   307 IPEVKRYEGWLFPSFEVAFTAFHTCTRKg-iHPCTMRLYDEDDTRLSFAASTDSglvstffsk-cfkkyiatvKGWNLSK 384 Trypanosoma brucei
Q9RJ97   274 APEVRRYEGWRFASFDEGTAALRRLAQDg-pRPTVLRLSDETETLIGLAQPDAVg-----------------aSLERQDA 335 Streptomyces coelic...
O05784   269 RPRWQVTVSVVFDDWAAAVAATRTIAQAg-lYPANCRLLDPAEALLNAGTSVG--------------------------- 320 Mycobacterium tuber...
Q9HZI0   264 LAEDERFYSVFLPNWQQALQATRELAQAr-vPLSMLRLSNAVETMTQLALAGHPgqiawl--------ekylaLRGAGEG 334 Pseudomonas aeruginosa
O23240   309 KLSSVNLAFIACKDYLSCQKLLVEAKRNlgeILSAFEFLDNNSMDLVLNHLDGVr------------------NPVSSSE 370 thale cress
EDX16897 289 ssRAVNVAFIGLNSFDDVLKTFVSAKRNlgeILSSCELIDERALNTALEQFKFL-------------------NSPISGF 349 Drosophila simulans
2UUV_A   392 VCLSIIGFEGPKKVVDFHRTSvfDILSKNAAFGLGS------------ApgKTWAEKRYDLPyIRDFLLDHNMWVDVAET 459 Dictyostelium disco...
Q9EQR2   449 ISVATLLFEGDREKVLQHEKQvyDIAAKFGGLAAGE------------DngQRGYLLTYVIAyMRDLGLEYYVVGESFET 516 Norway rat
Q9V778   415 ICAATLLFEGDLKDVQRQEALiyEIAEKFQGFPAGG------------QngERGYILTFVIAyIRDFGLHQGIVAESFET 482 fruit fly
O45218   392 ICAATCVYEGNREEVDQHEERlnKLAEQFHGVVGGA------------EngQYGYRLTFAIAyLRDLGMNHGVLGESFET 459 Caenorhabditis elegans
Q585R0   385 ISLVVVGFEGTKAQTNCQRSElvGVFQAFGATCLGTk-----------Pg-NTWQEKKYDLPyLRDFALAHNFWADVFET 452 Trypanosoma brucei
Q9RJ97   336 GCLAVVGFEGTGEDTAHRREGaaEILRESGGTFAGE------------EpgERWAHGRYSAPyLRDALLDAGALAETLET 403 Streptomyces coelic...
O05784   321 GGLLVLAFESADHPIDPWLHRavAITAEHGGTVTAQrsrgttsdatehNaaANWRSAFLRMPyQRDALVRRGVIAETFET 400 Mycobacterium tuber...
Q9HZI0   335 KCMLTFGVTGNRRQNGLSLSQakALLKRFGGVFTGT------------LlgRKWAQNRFRFPyLREALWQAGYAVDTLET 402 Pseudomonas aeruginosa
O23240   371 NFYILIETTGSDETNDREKLEa-FLLKSLEKGLVSDgviaq--dinqaS--SFWRIREGITE-----ALQKAGAVYKYDL 440 thale cress
EDX16897 350 PFYMLIETSGSNGDHDEEKINq-FIGDGMERGEIQDgtvtg--dpgkvQ--EIWKIREMVPL-----GLIEKSFCFKYDI 419 Drosophila simulans
2UUV_A   460 TVSYANLQTLWKDAKQTFVKHFkdqg--ipaWICAHISHTYTNGVCLYFIFASK--QNENKDmAQYIEAkklmTDIIFKY 535 Dictyostelium disco...
Q9EQR2   517 SAPWDRVIDLCRNVKERIRRECkergvqfapLSTCRVTQTYDAGACIYFYFAFNyrGISDPL-TVFEQTeaaaRDEILAN 595 Norway rat
Q9V778   483 SVPWDRCSLLCRSVKQRVVSECskrs-inyyTISCRVTQTYDAGACIYFYFGFRstDVADPV-ELFEAIehsaRDEILSC 560 fruit fly
O45218   460 SVPWDKVLSLCRNVKELMKREAkaqgvthpvLANCRVTQVYDAGACVYFYFGFNarGLKNGL-EVYDRIetaaRDEIIAC 538 Caenorhabditis elegans
Q585R0   453 SVLYTDAIHCWRAVKKSFAEVMaeng--knaWIGCHTAHQYRFGCCLYFTFIGG--QADENDlKIFLQVkkraMEVMLQH 528 Trypanosoma brucei
Q9RJ97   404 AALWSRLPALYAAVREALTATLtaag--tppLVMCHISHVYENGASLYFTVVS---AQGEDAvAHWTRAkhaaNDAILAA 478 Streptomyces coelic...
O05784   401 ACTWDGFDTLHAAVTDAARTAIwkvc--gtgVVTCRFTHVYPDGPAPYYGIYAG--GRWGSLdAQWDEIkaavSEAISAS 476 Mycobacterium tuber...
Q9HZI0   403 ATDWSNVDGLLQKIEASLRDGLaaeg--ekvHVFTHLSHVYGEGSSIYTTYVFRpaASYAATlERWKRLkhaaSQAIVDN 480 Pseudomonas aeruginosa
O23240   441 SLPVEEIYNIVNDLRGRLGDLA----------NVMGYGHLGDGNLHLNISAAEYndKLLGLIePYVYEW-------TSKH 503 thale cress
EDX16897 420 SLPLRDFYNIVDVMRERCGPLA---------TVVCGYGHLGDSNLHLNVSCEQFndEIYKRVePFVYEY-------TSKL 483 Drosophila simulans
2UUV_A   536 GGSLSHHHGVGYEHVPWMTRYATRGWINVYRSLKETIDPKDICNPrkL 583 Dictyostelium discoideum
Q9EQR2   596 GGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKDYVDPSNIFGNrnL 643 Norway rat
Q9V778   561 GGSLSHHHGVGKIRSHWYRNAVTETGSSLYSAAKRHLDPKNIFA---L 605 fruit fly
O45218   539 GGSISHHHGVGKIRKQWMLTTNGAVGIALLKAIKSELDPANIFAS--A 584 Caenorhabditis elegans
Q585R0   529 RGNLTHHHGIGYEHVPWMKRYNGEGGLDAIMKFKKALDPKNICNPgkL 576 Trypanosoma brucei
Q9RJ97   479 GGTITHHHAVGTDHRDWYVREAGPLGVEALRAVKRSLDPAGLLSPg-V 525 Streptomyces coelicolor
O05784   477 GGTITHHHAVGRDHRAWYDRQRPDPFAAALRAAKSALDPAGILNPg-V 523 Mycobacterium tuberculosis
Q9HZI0   481 RGTISHQHGVGKDHAPYLPREKGELGVAALRAMAGHFDPAGRLNRg-T 527 Pseudomonas aeruginosa
O23240   504 RGSISAEHGLGVMKANEIFYSKSPETVALMASIKKLLDPKGILNPykV 551 thale cress
EDX16897 484 KGSISAEHGIGFLKKDYLHYSKDPVAIGYMREMKKLLDPNSILNPykV 531 Drosophila simulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap