2UUV


Conserved Protein Domain Family
FAD-oxidase_C

?
pfam02913: FAD-oxidase_C 
Click on image for an interactive view with Cn3D
FAD linked oxidases, C-terminal domain
This domain has a ferredoxin-like fold.
Statistics
?
PSSM-Id: 397178
Aligned: 47 rows
Threshold Bit Score: 135.135
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UUV_A 314 VPQAVEYYGFLFPTFAHAVSALQQIRSSe-vIPTMIRVYDPEETQLSFAWKPSKgavseftsa-mvkkylhyiRSFDFKN 391 Dictyostelium discoideum
Q9EQR2 370 TPEYQKYGSVAFPNFEQGVACLREIAKQr-cAPASIRLMDNQQFQFGHALKPQVssiftsfldgfkkfyitkfKGFDPNQ 448 Norway rat
Q9V778 337 LPSLRRYGSLAFPNFEQGVLFMREVARRr-cQPASVRLMDNEQFMFGQALKPEKswwasvvda-mkqryvtswKGIDLNQ 414 fruit fly
O45218 313 IPEVKRFGSFVFPNFESGVNFFREVAIQr-cQPASLRLMDNDQFVMGQALKVASdswwadlkssvskmyitswKGFKVDE 391 Caenorhabditis elegans
Q585R0 307 IPEVKRYEGWLFPSFEVAFTAFHTCTRKg-iHPCTMRLYDEDDTRLSFAASTDSglvstffsk-cfkkyiatvKGWNLSK 384 Trypanosoma brucei
Q9RJ97 274 APEVRRYEGWRFASFDEGTAALRRLAQDg-pRPTVLRLSDETETLIGLAQPDAVg-----------------aSLERQDA 335 Streptomyces coelicolor
O05784 269 RPRWQVTVSVVFDDWAAAVAATRTIAQAg-lYPANCRLLDPAEALLNAGTSVG--------------------------- 320 Mycobacterium tubercu...
Q9HZI0 264 LAEDERFYSVFLPNWQQALQATRELAQAr-vPLSMLRLSNAVETMTQLALAGHPgqiawl--------ekylaLRGAGEG 334 Pseudomonas aeruginosa
P46681 277 KPKAFNVSYLSVESFEDVQKVFVRARQElseILSAFEFMDAKSQVLAKSQLKDAa------------------FPLEDEH 338 Saccharomyces cerevis...
O23240 309 KLSSVNLAFIACKDYLSCQKLLVEAKRNlgeILSAFEFLDNNSMDLVLNHLDGVr------------------NPVSSSE 370 thale cress
2UUV_A 392 VCLSIIGFEGPKKVVDFHRTSvfDILSKNAAFGLGS------------ApgKTWAEKRYDLPyIRDFLLDHNMWVDVAET 459 Dictyostelium discoideum
Q9EQR2 449 ISVATLLFEGDREKVLQHEKQvyDIAAKFGGLAAGE------------DngQRGYLLTYVIAyMRDLGLEYYVVGESFET 516 Norway rat
Q9V778 415 ICAATLLFEGDLKDVQRQEALiyEIAEKFQGFPAGG------------QngERGYILTFVIAyIRDFGLHQGIVAESFET 482 fruit fly
O45218 392 ICAATCVYEGNREEVDQHEERlnKLAEQFHGVVGGA------------EngQYGYRLTFAIAyLRDLGMNHGVLGESFET 459 Caenorhabditis elegans
Q585R0 385 ISLVVVGFEGTKAQTNCQRSElvGVFQAFGATCLGTk-----------Pg-NTWQEKKYDLPyLRDFALAHNFWADVFET 452 Trypanosoma brucei
Q9RJ97 336 GCLAVVGFEGTGEDTAHRREGaaEILRESGGTFAGE------------EpgERWAHGRYSAPyLRDALLDAGALAETLET 403 Streptomyces coelicolor
O05784 321 GGLLVLAFESADHPIDPWLHRavAITAEHGGTVTAQrsrgttsdatehNaaANWRSAFLRMPyQRDALVRRGVIAETFET 400 Mycobacterium tubercu...
Q9HZI0 335 KCMLTFGVTGNRRQNGLSLSQakALLKRFGGVFTGT------------LlgRKWAQNRFRFPyLREALWQAGYAVDTLET 402 Pseudomonas aeruginosa
P46681 339 PFYILIETSGSNKDHDDSKLEt-FLENVMEEGIVTDgvvaq--detelQ--NLWKWREMIPE-----ASQANGGVYKYDV 408 Saccharomyces cerevis...
O23240 371 NFYILIETTGSDETNDREKLEa-FLLKSLEKGLVSDgviaq--dinqaS--SFWRIREGITE-----ALQKAGAVYKYDL 440 thale cress
2UUV_A 460 TVSYANLQTLWKDAKQTFVKHFkdqg--ipaWICAHISHTYTNGVCLYFIFASK--QNENKDmAQYIEAkklmTDIIFKY 535 Dictyostelium discoideum
Q9EQR2 517 SAPWDRVIDLCRNVKERIRRECkergvqfapLSTCRVTQTYDAGACIYFYFAFNyrGISDPL-TVFEQTeaaaRDEILAN 595 Norway rat
Q9V778 483 SVPWDRCSLLCRSVKQRVVSECskrs-inyyTISCRVTQTYDAGACIYFYFGFRstDVADPV-ELFEAIehsaRDEILSC 560 fruit fly
O45218 460 SVPWDKVLSLCRNVKELMKREAkaqgvthpvLANCRVTQVYDAGACVYFYFGFNarGLKNGL-EVYDRIetaaRDEIIAC 538 Caenorhabditis elegans
Q585R0 453 SVLYTDAIHCWRAVKKSFAEVMaeng--knaWIGCHTAHQYRFGCCLYFTFIGG--QADENDlKIFLQVkkraMEVMLQH 528 Trypanosoma brucei
Q9RJ97 404 AALWSRLPALYAAVREALTATLtaag--tppLVMCHISHVYENGASLYFTVVS---AQGEDAvAHWTRAkhaaNDAILAA 478 Streptomyces coelicolor
O05784 401 ACTWDGFDTLHAAVTDAARTAIwkvc--gtgVVTCRFTHVYPDGPAPYYGIYAG--GRWGSLdAQWDEIkaavSEAISAS 476 Mycobacterium tubercu...
Q9HZI0 403 ATDWSNVDGLLQKIEASLRDGLaaeg--ekvHVFTHLSHVYGEGSSIYTTYVFRpaASYAATlERWKRLkhaaSQAIVDN 480 Pseudomonas aeruginosa
P46681 409 SLPLKDLYSLVEATNARLSEAElvgdspkpvVGAIGYGHVGDGNLHLNVAVREYnkNIEKTLePFVYEF-------VSSK 481 Saccharomyces cerevis...
O23240 441 SLPVEEIYNIVNDLRGRLGDLA----------NVMGYGHLGDGNLHLNISAAEYndKLLGLIePYVYEW-------TSKH 503 thale cress
2UUV_A 536 GGSLSHHHGVGYEHVPWMTRYATRGWINVYRSLKETIDPKDICNPrkL 583 Dictyostelium discoideum
Q9EQR2 596 GGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKDYVDPSNIFGNrnL 643 Norway rat
Q9V778 561 GGSLSHHHGVGKIRSHWYRNAVTETGSSLYSAAKRHLDPKNIFA---L 605 fruit fly
O45218 539 GGSISHHHGVGKIRKQWMLTTNGAVGIALLKAIKSELDPANIFAS--A 584 Caenorhabditis elegans
Q585R0 529 RGNLTHHHGIGYEHVPWMKRYNGEGGLDAIMKFKKALDPKNICNPgkL 576 Trypanosoma brucei
Q9RJ97 479 GGTITHHHAVGTDHRDWYVREAGPLGVEALRAVKRSLDPAGLLSPg-V 525 Streptomyces coelicolor
O05784 477 GGTITHHHAVGRDHRAWYDRQRPDPFAAALRAAKSALDPAGILNPg-V 523 Mycobacterium tuberculosis
Q9HZI0 481 RGTISHQHGVGKDHAPYLPREKGELGVAALRAMAGHFDPAGRLNRg-T 527 Pseudomonas aeruginosa
P46681 482 HGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPykY 529 Saccharomyces cerevisiae S288C
O23240 504 RGSISAEHGLGVMKANEIFYSKSPETVALMASIKKLLDPKGILNPykV 551 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap