NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|114596937|ref|XP_517543|]
View 

PREDICTED: glycine receptor subunit alpha-3 isoform X1 [Pan troglodytes]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Neur_chan_LBD pfam02931
Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ...
47-253 2.49e-65

Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure.


:

Pssm-ID: 251626  Cd Length: 215  Bit Score: 211.35  E-value: 2.49e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   47 LDKLMgrtSGYDARIRPN-FKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAY--SEYPD-DSLDLDPsm 122
Cdd:pfam02931   5 LDDLL---SGYDKRVRPVeNGSDPVTVSVGLYLTQIIDVDEKNQDLTTNVWLRQQWTDERLAWnpEDYGGiTSLRLPS-- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  123 lDSIWKPDLFFANeKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFE 202
Cdd:pfam02931  80 -DKIWKPDIVLYN-NADGIHDVTTPNTNVRVYPDGTVLWSPPAIYKSSCPIDVTYFPFDEQNCSLKFGSWTYNGEEVDLQ 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 114596937  203 WQDEAPVQVAEGLTLPQFLLKEEKDLRY--CTKHYNTGKFTC-----IEVRFHLERQM 253
Cdd:pfam02931 158 WEDDTPPVELEEIDLSDFTENGEWDIVDvpAKRNENPYGCYSelysdVTFYFTLRRKP 215
Neur_chan_memb pfam02932
Neurotransmitter-gated ion-channel transmembrane region; This family includes the four ...
260-448 9.53e-49

Neurotransmitter-gated ion-channel transmembrane region; This family includes the four transmembrane helices that form the ion channel.


:

Pssm-ID: 251627  Cd Length: 228  Bit Score: 168.22  E-value: 9.53e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  260 MYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVN- 338
Cdd:pfam02932   1 LIIPCVLISFLSWLVFWLPADAGPEKVTLGITTLLTMTVFLLLIRESLPKTSYVVPLIGKYLVFTMFVFTASVEYAVVVl 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  339 FVS----RQHK-----------ELLRFRRKRKNKTEAFALEKFYRFSDMD----------DEVRESRFSFTAYGMGPCLQ 393
Cdd:pfam02932  81 NVHhrspSTHKmpewvrklflrKLPRLLFMKRPPESLSPPAAPHLRSSSSssgsvlepasGKESKGVGGPETSSGLPGGS 160
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 114596937  394 AKDGMTPK-----------GPNHPVQVMpKSPDEMRKVFID---RAKKIDTISRACFPLAFLIFNIFYW 448
Cdd:pfam02932 161 GSGLGSPFrlspelkkaleGVRFIAEHL-RSRDEFDEVKEDwkyVAMVIDRLSRWIFPIAFVLGTLVYW 228
Neuronal_acetylcholine_receptor_subunit_alpha-7 TIGR00860
Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of ...
12-451 0e+00

Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective). [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 273305 [Multi-domain]  Cd Length: 459  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   12 SGFYFWEAALLLSLVATKETDSARSRSAPMSPsDFLDKLMGrtsGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDY 91
Cdd:TIGR00860   1 LSQILLALLLFASLAAVSLAGNAKSNLKEVER-KLLDELLK---NYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   92 RVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSC 171
Cdd:TIGR00860  77 TTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLAC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  172 PMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGL--TLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHL 249
Cdd:TIGR00860 157 PMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLfiSLPEFELLGVYGTRYCTSETNTGEYPCLTFSFVL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  250 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFS 329
Cdd:TIGR00860 237 RRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAVCMAFVFL 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  330 ALLEYAAVNFVSR-----QHKELLRFRRKRknkteafalekFYRFSDMDDEVResRFSFTAYGMGP-CLQAKD-GMTPKG 402
Cdd:TIGR00860 317 ALLETAFVNYVHHkdpaqGKRHLLLERCAW-----------RLCKQEPGEDYR--RPALDHASLSSvEMRAKDgGRGLES 383
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 114596937  403 PNHPVQVMPKSP------------------------DEMRKVFID---RAKKIDTISRACFPLAFLIFNIFYWVIY 451
Cdd:TIGR00860 384 PTERQRLLHSPPpaegdldlagileevriahrfrkrDESEEVVRDwkfRAKVIDKLSRMAFPLAFLLFNIGYWMSY 459
 
Name Accession Description Interval E-value
Neur_chan_LBD pfam02931
Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ...
47-253 2.49e-65

Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure.


Pssm-ID: 251626  Cd Length: 215  Bit Score: 211.35  E-value: 2.49e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   47 LDKLMgrtSGYDARIRPN-FKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAY--SEYPD-DSLDLDPsm 122
Cdd:pfam02931   5 LDDLL---SGYDKRVRPVeNGSDPVTVSVGLYLTQIIDVDEKNQDLTTNVWLRQQWTDERLAWnpEDYGGiTSLRLPS-- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  123 lDSIWKPDLFFANeKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFE 202
Cdd:pfam02931  80 -DKIWKPDIVLYN-NADGIHDVTTPNTNVRVYPDGTVLWSPPAIYKSSCPIDVTYFPFDEQNCSLKFGSWTYNGEEVDLQ 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 114596937  203 WQDEAPVQVAEGLTLPQFLLKEEKDLRY--CTKHYNTGKFTC-----IEVRFHLERQM 253
Cdd:pfam02931 158 WEDDTPPVELEEIDLSDFTENGEWDIVDvpAKRNENPYGCYSelysdVTFYFTLRRKP 215
Neur_chan_memb pfam02932
Neurotransmitter-gated ion-channel transmembrane region; This family includes the four ...
260-448 9.53e-49

Neurotransmitter-gated ion-channel transmembrane region; This family includes the four transmembrane helices that form the ion channel.


Pssm-ID: 251627  Cd Length: 228  Bit Score: 168.22  E-value: 9.53e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  260 MYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVN- 338
Cdd:pfam02932   1 LIIPCVLISFLSWLVFWLPADAGPEKVTLGITTLLTMTVFLLLIRESLPKTSYVVPLIGKYLVFTMFVFTASVEYAVVVl 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  339 FVS----RQHK-----------ELLRFRRKRKNKTEAFALEKFYRFSDMD----------DEVRESRFSFTAYGMGPCLQ 393
Cdd:pfam02932  81 NVHhrspSTHKmpewvrklflrKLPRLLFMKRPPESLSPPAAPHLRSSSSssgsvlepasGKESKGVGGPETSSGLPGGS 160
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 114596937  394 AKDGMTPK-----------GPNHPVQVMpKSPDEMRKVFID---RAKKIDTISRACFPLAFLIFNIFYW 448
Cdd:pfam02932 161 GSGLGSPFrlspelkkaleGVRFIAEHL-RSRDEFDEVKEDwkyVAMVIDRLSRWIFPIAFVLGTLVYW 228
Neuronal_acetylcholine_receptor_subunit_alpha-7 TIGR00860
Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of ...
12-451 0e+00

Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273305 [Multi-domain]  Cd Length: 459  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   12 SGFYFWEAALLLSLVATKETDSARSRSAPMSPsDFLDKLMGrtsGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDY 91
Cdd:TIGR00860   1 LSQILLALLLFASLAAVSLAGNAKSNLKEVER-KLLDELLK---NYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   92 RVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSC 171
Cdd:TIGR00860  77 TTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLAC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  172 PMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGL--TLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHL 249
Cdd:TIGR00860 157 PMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLfiSLPEFELLGVYGTRYCTSETNTGEYPCLTFSFVL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  250 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFS 329
Cdd:TIGR00860 237 RRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAVCMAFVFL 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  330 ALLEYAAVNFVSR-----QHKELLRFRRKRknkteafalekFYRFSDMDDEVResRFSFTAYGMGP-CLQAKD-GMTPKG 402
Cdd:TIGR00860 317 ALLETAFVNYVHHkdpaqGKRHLLLERCAW-----------RLCKQEPGEDYR--RPALDHASLSSvEMRAKDgGRGLES 383
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 114596937  403 PNHPVQVMPKSP------------------------DEMRKVFID---RAKKIDTISRACFPLAFLIFNIFYWVIY 451
Cdd:TIGR00860 384 PTERQRLLHSPPpaegdldlagileevriahrfrkrDESEEVVRDwkfRAKVIDKLSRMAFPLAFLLFNIGYWMSY 459
 
Name Accession Description Interval E-value
Neur_chan_LBD pfam02931
Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ...
47-253 2.49e-65

Neurotransmitter-gated ion-channel ligand binding domain; This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure.


Pssm-ID: 251626  Cd Length: 215  Bit Score: 211.35  E-value: 2.49e-65
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   47 LDKLMgrtSGYDARIRPN-FKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAY--SEYPD-DSLDLDPsm 122
Cdd:pfam02931   5 LDDLL---SGYDKRVRPVeNGSDPVTVSVGLYLTQIIDVDEKNQDLTTNVWLRQQWTDERLAWnpEDYGGiTSLRLPS-- 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  123 lDSIWKPDLFFANeKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFE 202
Cdd:pfam02931  80 -DKIWKPDIVLYN-NADGIHDVTTPNTNVRVYPDGTVLWSPPAIYKSSCPIDVTYFPFDEQNCSLKFGSWTYNGEEVDLQ 157
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 114596937  203 WQDEAPVQVAEGLTLPQFLLKEEKDLRY--CTKHYNTGKFTC-----IEVRFHLERQM 253
Cdd:pfam02931 158 WEDDTPPVELEEIDLSDFTENGEWDIVDvpAKRNENPYGCYSelysdVTFYFTLRRKP 215
Neur_chan_memb pfam02932
Neurotransmitter-gated ion-channel transmembrane region; This family includes the four ...
260-448 9.53e-49

Neurotransmitter-gated ion-channel transmembrane region; This family includes the four transmembrane helices that form the ion channel.


Pssm-ID: 251627  Cd Length: 228  Bit Score: 168.22  E-value: 9.53e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  260 MYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVN- 338
Cdd:pfam02932   1 LIIPCVLISFLSWLVFWLPADAGPEKVTLGITTLLTMTVFLLLIRESLPKTSYVVPLIGKYLVFTMFVFTASVEYAVVVl 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  339 FVS----RQHK-----------ELLRFRRKRKNKTEAFALEKFYRFSDMD----------DEVRESRFSFTAYGMGPCLQ 393
Cdd:pfam02932  81 NVHhrspSTHKmpewvrklflrKLPRLLFMKRPPESLSPPAAPHLRSSSSssgsvlepasGKESKGVGGPETSSGLPGGS 160
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 114596937  394 AKDGMTPK-----------GPNHPVQVMpKSPDEMRKVFID---RAKKIDTISRACFPLAFLIFNIFYW 448
Cdd:pfam02932 161 GSGLGSPFrlspelkkaleGVRFIAEHL-RSRDEFDEVKEDwkyVAMVIDRLSRWIFPIAFVLGTLVYW 228
Neuronal_acetylcholine_receptor_subunit_alpha-7 TIGR00860
Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of ...
12-451 0e+00

Cation transporter family protein; The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective). [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273305 [Multi-domain]  Cd Length: 459  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   12 SGFYFWEAALLLSLVATKETDSARSRSAPMSPsDFLDKLMGrtsGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDY 91
Cdd:TIGR00860   1 LSQILLALLLFASLAAVSLAGNAKSNLKEVER-KLLDELLK---NYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDY 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937   92 RVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSC 171
Cdd:TIGR00860  77 TTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLAC 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  172 PMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGL--TLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHL 249
Cdd:TIGR00860 157 PMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLfiSLPEFELLGVYGTRYCTSETNTGEYPCLTFSFVL 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  250 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFS 329
Cdd:TIGR00860 237 RRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAVCMAFVFL 316
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114596937  330 ALLEYAAVNFVSR-----QHKELLRFRRKRknkteafalekFYRFSDMDDEVResRFSFTAYGMGP-CLQAKD-GMTPKG 402
Cdd:TIGR00860 317 ALLETAFVNYVHHkdpaqGKRHLLLERCAW-----------RLCKQEPGEDYR--RPALDHASLSSvEMRAKDgGRGLES 383
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 114596937  403 PNHPVQVMPKSP------------------------DEMRKVFID---RAKKIDTISRACFPLAFLIFNIFYWVIY 451
Cdd:TIGR00860 384 PTERQRLLHSPPpaegdldlagileevriahrfrkrDESEEVVRDwkfRAKVIDKLSRMAFPLAFLLFNIGYWMSY 459
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH