Conserved Protein Domain Family
CreD

?
pfam06123: CreD 
Inner membrane protein CreD
This family consists of several bacterial CreD or Cet inner membrane proteins. Dominant mutations of the cet gene of Escherichia coli result in tolerance to colicin E2 and increased amounts of an inner membrane protein with an Mr of 42,000. The cet gene is shown to be in the same operon as the phoM gene, which is required in a phoR background for expression of the structural gene for alkaline phosphatase, phoA. Although the Cet protein is not required for phoA expression, it has been suggested that the Cet protein has an enhancing effect on the transcription of phoA.
Statistics
?
PSSM-Id: 399257
Aligned: 75 rows
Threshold Bit Score: 341.455
Threshold Setting Gi: 373909387
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1LMU3                   6 SYPYKILVAAGLILVLWAALQMVFNLVEERSQLQESAEQSIWRSYAGPQTLTGPIIVLPYKEVLVESEAKDakgrktQTQ 85  Cupri...
instpast:LEPBI_I0397     7 SVNIRLLILGVMVILFIIPLSMVGSLIVERSQSRIEAVAEVGEKWSRNQTLIGPFLVIPYNIRIPKSGNSHs-----KEK 81  Lepto...
jgi:Spirs_1049           5 rYGVKLIVILILLILFAIPLRMVRQIVKERESRSREAAEDVIDSWGGRSTISGPYLLIPVYRFEETRSVEG------KPV 78  Sedim...
CCY75640                11 TFGFKIFTILILGLFLLIPMTFIDSVVRDRKNYQSEAVASIIEPIGGEANIEGLIMAIPYLKKVIYEN---------TKE 81  Brach...
WP_013759055            20 KMGAKPFIILFLVLLFLIPLNLVKSLIRDREYYRNEAVESILLPKGGEPVLEGFVTALPYTVTTEKKLSDG------SVE 93  Trepo...
WP_012415341             9 kIILKAGVIGVLLLLMLIPLSFVKGVVKERSNYKNDAFKTISGSWGKDQLIAAPFLNVPYSYIYQEKDKDG--------K 80  Elusi...
jgi:Astex_0214          16 sKGTKFLVVCALAVLMAIPALLVFALLMERTNRAEGVAREIGDQMGGEQVFLGPVIQVPYVIPTRTSTDEKg----nRVV 91  Astic...
WP_015828088            30 SFGLKLLLVCALALLMAIPTMFVWGVVKERTTNAQQAVQEVSLARGGEQIVLGPVLSIPYEQIVTERVPNNsg--vmIDT 107 Hirsc...
PRJNA229194:W911_15135  14 SPAFKFFLIAFLIVLLLVPLFMVVGLVMEREGRSRDVIREVGRTWGGMQQITGPYLVVPYSVRIETQEGDK-------VV 86  Hypho...
Q7CZV1                  31 SPGAKFLMIGFISLVLLVPLLLVWGLTEERASRAREVSARIANGWGGDQVVNGPYLAVPFDVERRREVDGR-------TI 103 Agrob...
Q1LMU3                  86 YREATRQLL--VFPKSLQVQTEIKPSERYRGIHKAIVYEAASQWTGTFVLpdLKAATAFEKSaghVRFELGEPFVALGVS 163 Cupri...
instpast:LEPBI_I0397    82 WDYTTEYAY--FLPDELSYQVEMLTEERKRGIYQIPLYTNKIYAKGKFAP--VRSTDFPTDT---TYIYWDDVRLIVSVS 154 Lepto...
jgi:Spirs_1049          79 QQKIERTAL--FFPDSLNVDIHAETEKRSRGIFSVPVYNASILLEGSFRL---EELNERLSG---YTIDEEGIRIGLSLG 150 Sedim...
CCY75640                82 ITYKREYIF--YMPNSYNIFGNVEISLLKRGIFKVPVLNSTLNIKGKFDKynSDLYNLNEKD---AEILFDEAIIIFGIG 156 Brach...
WP_013759055            94 RTEKIRYMI--AVPESWALRADVSPEYLTRGIFEVPVFSCSAVSEGSFAP--AAYGYRNVSE---SDILWDQALLLLGVS 166 Trepo...
WP_012415341            81 VKDVKRYGIykISPSKLEADVNIIPQIRYIGIFKLPVYTAEVTLKGAFGK------MDDTEG---RTVDLSKTQMTIEVA 151 Elusi...
jgi:Astex_0214          92 LAQESGNLI--VFPQTGKASAATKSDVRSRSIFRVPVYTADLNFDAAFDL---KDVQASRPG---AVLMWDKAQLVTGAT 163 Astic...
WP_015828088           108 QRKKTGEFV--VFGTSGFARADLKTEMLKRSLHRVPVFDVNIDFKASFDL--EQAMLNKPRG---ATLHWDDARIHMGMS 180 Hirsc...
PRJNA229194:W911_15135  87 QRVVERRAV--FLPDELLVSGDAKSGLLHRSIFDVNVYTAALSITGRFSV--PDVSDVDPNA---IAVRWKDATFALALN 159 Hypho...
Q7CZV1                 104 VDRTTEWAL--VMPETLQVTADLKTEEKKLSIYSLPVYNGALVLKGRFGQ--GVLQDLARFA---GTPRLDNAILVLSIG 176 Agrob...
Q1LMU3                 164 DMRGLAAAPVMQLA-GKSLEMeQ----------------------------------------GAQLNG----------- 191 Cupri...
instpast:LEPBI_I0397   155 DLKGLGGDLKLTWN-GKEKYF-Sp---------------------------------------GTKSNF----------- 182 Lepto...
jgi:Spirs_1049         151 ELSGIRAIDEAMFG-DTKLTL-Epmg---------------------------------------------------tdi 177 Sedim...
CCY75640               157 NKKNLLKLPKIIIN-------------------------------------------------ENEELKy---------- 177 Brach...
WP_013759055           167 NKKNLTSLPVVTAN-GTDLETaLia------------------------------------------------------- 190 Trepo...
WP_012415341           152 DLKGVAKLPEGSFN-NRKLDF-ApytgsnavlfssalgndedykdiavltktedsmrghykeyGSYGNRpgnq----lka 225 Elusi...
jgi:Astex_0214         164 DSRGARKDIVAQIN-GASVMMaPsg-------------------------------------pGVTGFSp---------- 195 Astic...
WP_015828088           181 DLRGIKDDVLVQIG-EEKISL------------------------------------------GPGNGA----------- 206 Hirsc...
PRJNA229194:W911_15135 160 DVAGLKEAATLALNrRDRLPF-Qps-------------------------------------iGVPVSN----------- 190 Hypho...
Q7CZV1                 177 DITGIRSSAGVRINgGAVLPF-Dp---------------------------------------GMRDMSviasralenns 216 Agrob...
Q1LMU3                 192 LGQG---LHAELDLrga-----agKPADARVVPFSLTLSLLGSRSIAFAPVADMNTFSMRSAWPHPSFDGDFLPR--QRT 261 Cupri...
instpast:LEPBI_I0397   183 FPSG---MNLPIQ-----------LEENIGFSNFNMDISLKGSESFSIIPIGKKTKMQMESNWKDPSFNGNLLPV--DRE 246 Lepto...
jgi:Spirs_1049         178 LLQGn-rITAPVGLt---------VKALKDSMPYRFRLRIGGGQSISILPVARQTEVAMRSDWENPSFFGSALPVrhDGG 247 Sedim...
CCY75640               178 YEKT---VKINLPMfsniflfnisKEKLFNGFEFETSIDIQGGNSLIINPMASDNYFNISSKWRDPSFTGGFLPT--KRE 252 Brach...
WP_013759055           191 -pEG-------VSPfshtvfyrlpDDAARSGFAFTCDASVQGGGSLSAVPMAADNRFTVTSDWPTPGFSGGWLPT--ERH 260 Trepo...
WP_012415341           226 IGSA--------------------VNYSNTSSDFEVKFALRGSNTINFVPAAKENKFIVKSSWKDPLFFNSFLPD--SKT 283 Elusi...
jgi:Astex_0214         196 DGTDfdlFAAPLA-----------LSDTATPLEIKVGMTFTGTRKLGVLAYGKSSEATITGDWKYPSFGGGFLPA--TRQ 262 Astic...
WP_015828088           207 -------LSSSLSDtvgs--vrgiSLDENSVFDLTASMRLTGAQRIGFAAFAQNTSIELTGDWASPSFVGGFLPV--ERS 275 Hirsc...
PRJNA229194:W911_15135 191 -MNG---IHSKIGTaps----vvsPDGTLQAFSFEAELHFTGSLSLNFAPAARETRVEITSDWPHPSFGGAFLPV--ERD 260 Hypho...
Q7CZV1                 217 IRSDa-gVHRQID-----------RNLIESGFDFDIAFSLNGSGSFAVAPAGQTTSFTAKADWPHPGFEGLFLPE--VKT 282 Agrob...
Q1LMU3                 262 VDAS----GFRAEWSVNALNTHVRERLLpmengertqPAVTAPANAAESISVTLIDPVNGYVRVERAIKYGLLFVLLTFA 337 Cupri...
instpast:LEPBI_I0397   247 IFDT----GFRSNWESSYFSRSYPQVIHs-------iDDSIVNSLYDSAFGVNLLIPVDHYLKLERSIKYGLLFIVTSFT 315 Lepto...
jgi:Spirs_1049         248 DAEP----GFSALWSISHLSRNLPHFGFi--------SDLRSEEIDIEGFGVKFLNPDDPYPKNERSVTYAWLFLIVPFA 315 Sedim...
CCY75640               253 LSKN----GFNAEWNIASFNTSYNKYWTsee----enKNNEYKFEDNQNVIISFLLLNDNYQKILRSVKYSILFIFIPFF 324 Brach...
WP_013759055           261 VSDG----GFSAEWRIAGLSTVFPERWL---------SDAPHPVSSAESVRAGFVTPVDNYQKTMRSVKYAVLFLLIPFL 327 Trepo...
WP_012415341           284 ISSD----GFSAEWNISYLASGIAQMFE-------------SLDITPSIFGVKLSMPVDNYRNGLRSVKYGILFLSLTFL 346 Elusi...
jgi:Astex_0214         263 TDETarkgGFSAQWSVPFIARGLPAVID----------QNQMMTLGKSELSVTFVEPTNPYQSVGRSLKYALLFVGLVFL 332 Astic...
WP_015828088           276 ITDE----GFTANWKVPYLARGVEASGE----------NLQLYDLVQSNMGLRLLDETSPYQSVMRALKYAPMFIGLVFL 341 Hirsc...
PRJNA229194:W911_15135 261 VRAE----GFSAKWRIPHLARSVPHSWSl--------TEHGLDRFLNAQFGVTFYQPVDFYGLVTRAVKYGILFLAAGFM 328 Hypho...
Q7CZV1                 283 VTAA----DFNASWTIPYLARGIDRVVE-----------GPRLPLSNSLMTINLVEPVKFYQVIARTLKYSIGFISLVFL 347 Agrob...
Q1LMU3                 338 GFYVFEQIKGLRIHPIQYLLVGLALTLFFLMLVSLSEHVTFLLAYLAASAACIGLLAFYLTFVLHSWRRGASF---AALI 414 Cupri...
instpast:LEPBI_I0397   316 LFFLMEVFGGIILHPIQYILIGCTMIIFYVLNLSLSEHIGYLGAYMISSLAVTILIGYYSIHVLNNRKKGIIT---AMYY 392 Lepto...
jgi:Spirs_1049         316 AFFVFEAVKGEAVHPVQYLLTGCADIVFYLLLLSLSEHIPFFTAYMLAALGGSLLIAAYASAVLGSKTSGITL---GGII 392 Sedim...
CCY75640               325 VLFLCEVISKKRIHPVQYILIGISNAIFYLLLLAISEHINFNLSYLISAIMVVLLTSMYIGYIIKLKKYILYM---AIVE 401 Brach...
WP_013759055           328 TIFIFELFTGVRIHPVQYCLIGTADVVFYLLLLSVSEHVPFASTYWISSAAVCLLTLFYAASIFKKVKWGALF---AGVQ 404 Trepo...
WP_012415341           347 ACFVFEIAGKMPIHPFQYVLVGLAMAVFYLLLVSISEFIPFGWSYMIASAAVVLMVGAYARYGVIKKQGTKYFwipAGII 426 Elusi...
jgi:Astex_0214         333 TYFLFESTSKKELHPAQYILVGLAQITFYLLLLSFAERIGFDAAFVVAAGATVTLIAGYAGLIFHSRWRFMAA---FAVF 409 Astic...
WP_015828088           342 AYFLFETTSSMRTHPAQYVLVGLAQVVFYLLLLGVSEHTGFTAGFIVAASATVAALSLYAGAVFGGREARMNA---FIVF 418 Hirsc...
PRJNA229194:W911_15135 329 GVFVLELISKGRVHPVQYIFVGLAMVFFYVLLLSLAEHLGFTRAYAIASLATGGMLSLYVGKALHSLRSGVLM---AALF 405 Hypho...
Q7CZV1                 348 AVFIVELKGGSVVHWIQYVLTGLALIVFYVLLLALAEHTGFTVAYAAASFSTAALIAFYLGSATRSRRNGLAL---FSVL 424 Agrob...
Q1LMU3                 415 AALYGALYGILVSEDNALLLGSTLLFLVLASIMTVTRRVDWY 456 Cupriavidus metallidurans CH34
instpast:LEPBI_I0397   393 LSLYSFLYIILASEDQALLLGSITLFLILALVMHFTRKINWY 434 Leptospira biflexa serovar Patoc strain 'Pa...
jgi:Spirs_1049         393 IIAYAYLMVVLTSEDYALLLGSIGLFIALALIMFLTRNVSWY 434 Sediminispirochaeta smaragdinae DSM 11293
CCY75640               402 ILIYIFLFGILQLTDYAFLMGTLGLFIVIAAGMYFSRNVDWY 443 Brachyspira sp. CAG:700
WP_013759055           405 LVSYVFLFGTLQTEDYALLIGSLGLFCIVVLLMILTHKVDWY 446 Treponema brennaborense
WP_012415341           427 AVLYMYLYVLLQLQDLSLLLGSLGLFLGLGAVMYTTRNINWY 468 Elusimicrobium minutum
jgi:Astex_0214         410 GALYALIYVLMRMEDYALLVGACSAFLVIAAVMVLTRNINWY 451 Asticcacaulis excentricus CB 48
WP_015828088           419 TSLYALIYVLMRMQDYALLVGSIASFAAIAFTMWKTRELDWY 460 Hirschia baltica
PRJNA229194:W911_15135 406 SALYGLLYLILRLEDYALLAGALLGFTALTGLMFATLHIDWS 447 Hyphomicrobium nitrativorans NL23
Q7CZV1                 425 AVAYGVMYLVLNEDEYALLAGAVISFIAIAATMFATRKVDWS 466 Agrobacterium fabrum str. C58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap