2K4M


Conserved Protein Domain Family
UPF0146

?
pfam03686: UPF0146 
Click on image for an interactive view with Cn3D
Uncharacterized protein family (UPF0146)
The function of this family of proteins is unknown.
Statistics
?
PSSM-Id: 397649
Aligned: 4 rows
Threshold Bit Score: 183.876
Threshold Setting Gi: 13638552
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2K4M_A  22 WNDLAVYIIRCSGPGtRVVEVGAGRFLYVSDYIRKHSkVDLVLTDIKPS--------HGGIVRDDITSPRMEIYRGAALI 93  Methanothermobacter t...
P58015   1 MTQPPTVAAVLAAHS-RVVEVGIGARPDVAAALAERG-CAVTATDIEACtv----peTVRFVRDDVTDPERAVYEAADAV 74  Halobacterium salinar...
Q58101   6 IVEFIKKFAEENNCK-KIAEIGIGFKFDVARELSKY--FDLIAIDINEKaiekakllGLNAYKDDLFNPNISLYKNIDLI 82  Methanocaldococcus ja...
P58014   3 MLQIADYIA-ENYRG-KVVEVGIGRFTAVAELLARRG-FEVFATDVVERra----peGCRFYVDDVTKPNLKIYEGASLI 75  Archaeoglobus fulgidu...
2K4M_A  94 YSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIA 148 Methanothermobacter thermautotrophicus str. De...
P58015  75 YALRCPPELQRAVVDVAGAVGAACYLTTLGGEPVVVPVSERRTVASGALFVARDA 129 Halobacterium salinarum NRC-1
Q58101  83 YSIRPPRDLQPYILDLSKKVNANLIIRPLLNEMP--IKELKLKNYKGEVFYIKEK 135 Methanocaldococcus jannaschii DSM 2661
P58014  76 YSLRPPPELFSAIVEVSRKVGADCLIKPLYGDY----MEARIVNYKGAQFYLIRR 126 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap