Conserved Protein Domain Family
UPF0146

?
pfam03686: UPF0146 
Uncharacterized protein family (UPF0146)
The function of this family of proteins is unknown.
Statistics
?
Aligned: 4 rows
Threshold Bit Score: 180.796
Threshold Setting Gi: 13638552
Created: 19-Mar-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P58015   1 MTQPPTVAAVLAAHS-RVVEVGIGARPDVAAALAERG-CAVTATDIEACtv----peTVRFVRDDVTDPERAVYEAADAV 74  Halobacterium salinar...
O27081   2 WNDLAVYIIRCSGPGtRVVEVGAGRFLYVSDYIRKHSkVDLVLTDIKPS--------HGGIVRDDITSPRMEIYRGAALI 73  Methanothermobacter t...
Q58101   6 IVEFIKKFAEENNCK-KIAEIGIGFKFDVARELSKY--FDLIAIDINEKaiekakllGLNAYKDDLFNPNISLYKNIDLI 82  Methanocaldococcus ja...
P58014   3 MLQIADYIA-ENYRG-KVVEVGIGRFTAVAELLARRG-FEVFATDVVERra----peGCRFYVDDVTKPNLKIYEGASLI 75  Archaeoglobus fulgidu...
P58015  75 YALRCPPELQRAVVDVAGAVGAACYLTTLGGEPVVVPVSERRTVASGALFVARDA 129 Halobacterium salinarum NRC-1
O27081  74 YSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIA 128 Methanothermobacter thermautotrophicus str. De...
Q58101  83 YSIRPPRDLQPYILDLSKKVNANLIIRPLLNEMP--IKELKLKNYKGEVFYIKEK 135 Methanocaldococcus jannaschii DSM 2661
P58014  76 YSLRPPPELFSAIVEVSRKVGADCLIKPLYGDY----MEARIVNYKGAQFYLIRR 126 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap