Conserved Protein Domain Family
Glycos_transf_N

?
pfam04413: Glycos_transf_N 
3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase)
Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
Statistics
?
PSSM-Id: 427934
Aligned: 325 rows
Threshold Bit Score: 96.0147
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AEB09824         25 LPR-LGLRLPakn-hdARSTR--IWLHGVSVGEIAAAEPLVKELEHQTPQ-VQLLLSTGTETGQTVARRLYPpp--knVF 97  Desulfobacca...
jgi:DaAHT2_0899  41 RQR-LGFYPRtpl-ppSKTKR--LWLHAASVGEVQVARALIQELERQIPE-AEIWVSTLTRHGHQLCSTTMPat--vtSI 113 Desulfurivib...
WP_012175182     38 DQR-LGRYSGivd-lpKGPTR--IWIHAASVGEVRVAEAVIDEFRLAMPG-CTIVLSVMTASGHAVAETALAgk--avCV 110 Desulfococcu...
ESQ12948         35 GER-LALATPvir-ssKSGAI--IWIHAASIGEVRAARIVIDHCTRNWPE-SSVVLTTMTIHGRDYARTILPds--vfCL 107 Desulfofusti...
WP_014436873     34 AGR-FGRGPSgetlenAGGPR--ILFCAVSVGEVNALRGLVDALRSG-PEpCGLVLAVTTNTGVDRAQQLYGgregvaVV 109 Phycisphaera...
WP_015248437     35 AEKvLGRAPL------RIGDGpcLWFHAVSVGEVLLLRPIVEELARRRPG-WGVVVSTTTNTGLAVARRTFPdl---vTF 104 Singulisphae...
jgi:Plabr_0652   36 GEKlFGRVPK------RRGNQpcLWLHAVSVGEVLQLQPIIEGWKASHPD-GEIYVTTTTGTGREVAERTYPdc---tVC 105 Rubinisphaer...
WP_012913074     35 yEKlLGLVPR------RESRHrcLWLHAVSVGEVNLLMPIVERWERLHPD-WEIVISTTTATGFALAHKRYApr---mVF 104 Pirellula st...
WP_013044725     35 QHR-FGRFQRlpa-ptENTQR--VWLQAVSVGEVLAVGPLIDALQKF-GD-LEIVLTTTTSTGYAEARKRYAdkv-lcVG 107 Coraliomarga...
jgi:Oter_2533    35 QHR-FGRGHDlpp-krPGVRR--IWLQAVSVGEVLAIAPLLEALIKS-GE-AEVYLTTTTSTGHRLADERYFgfv-igLG 107 Opitutus ter...
AEB09824         98 YYPLDLPWTVRRYLEHLQPTIYAALETEIWPNFLMTAKRRGVKLALLNGRLSENSFRNYFR--FSCYLKYIIQLFDLIAA 175 Desulfobacca...
jgi:DaAHT2_0899 114 FAPLDLAGVCSLAMRRVAPDLYICLETELWPEIIRQAERRGAGPLLINARLSEKSFRRYRKwpASLLIGRTVGRFRAIAA 193 Desulfurivib...
WP_012175182    111 LVPLDFIFTVRRAMKTVRPDIFVCLETEIWPHLILEAKRFGAVTAILNGRISRQACHRYRF--IAPLVAETLRHVDLFSM 188 Desulfococcu...
ESQ12948        108 LAPLDVPFVVERAIKRLRPTIYVCLETELWPLLVAALHRRGIGTALLNGRISTRSLPRYRR--WRTLFGTVLNCFDGIGV 185 Desulfofusti...
WP_014436873    110 RYPLDFSWAVGRFLDAIRPDLVATVELELWPNFVAAARLRGVPVAIVNGRLSERSFRRYRL--ARPLVRSAFAAVAAAGV 187 Phycisphaera...
WP_015248437    105 YAPLDFSWATRQALSRVRPTVLALVELELWPNLVWSAKQAGARVAIVNGRLSHRSHRGYRR--LRGPLGPTLRRLDTVAV 182 Singulisphae...
jgi:Plabr_0652  106 YCPLDFTWAVGAALRRIRPNCVGLVELELWPNLITTADRRNVPLVLLNGRLSAKSFRGYRK--IRPLVRNLLQRFQLIAV 183 Rubinisphaer...
WP_012913074    105 YCPLDFTWSTAQAMHRIRPDLLVLTELELWPNLIRAARRSGVKVAVINGRLSEKSFRGYSR--VKRFLASTLQSIDTIAA 182 Pirellula st...
WP_013044725    108 IFPLDFVLFSKAAWRRIQPDAIILTESELWPEHLRCARKAGKPAFLVNARMSDRSFGRYLK--LRPLAAWLFGQLDHIYA 185 Coraliomarga...
jgi:Oter_2533   108 YFPIDWWLFSRRAWRDIDPDMVILMEGERWPEHIHQANLRQVPVISINARTSDRSFRRLRN--FGFANRLLFGGIDRLLP 185 Opitutus ter...
AEB09824        176 ASAEDAERFMALGAPpgKVFTTGTTKFER 204 Desulfobacca acetoxidans DSM 11109
jgi:DaAHT2_0899 194 IGEDDVERFRNLGAApeRIRLSGNAKYDL 222 Desulfurivibrio alkaliphilus AHT 2
WP_012175182    189 VSREDSDRIISLGAPgdRVYVGGNAKFRf 217 Desulfococcus oleovorans
ESQ12948        186 ISDEDRSRFLEIGADssRLRVTGNIKYDY 214 Desulfofustis sp. PB-SRB1
WP_014436873    188 QTQAYGRRFVALGTPaeRVRVLDTMKWDN 216 Phycisphaera mikurensis
WP_015248437    183 QNDEYAERFEDLGIPrqRIRVTGSIKYDg 211 Singulisphaera acidiphila
jgi:Plabr_0652  184 QNDEYAQRFRQLGADldQLLVAGSIKFDR 212 Rubinisphaera brasiliensis DSM 5305
WP_012913074    183 QNEEYASRFRALGANgeRVCVTGSIKFDg 211 Pirellula staleyi
WP_013044725    186 ASSLDQERLIALGARteTTVCAGSIKLDV 214 Coraliomargarita akajimensis
jgi:Oter_2533   186 CSAQDEARFRQLGVPaeKIFTTGNIKLDL 214 Opitutus terrae PB90-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap