Conserved Protein Domain Family
PCA_45_Doxase_B_like_1

?
cd07949: PCA_45_Doxase_B_like_1 
The B subunit of unknown Class III extradiol dioxygenases with similarity to Protocatechuate 4,5-dioxygenase.
This subfamily is composed of proteins of unknown function with similarity to the B subunit of Protocatechuate 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. LigAB-like enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents the catalytic subunit, B.
Statistics
?
PSSM-Id: 153386
View PSSM: cd07949
Aligned: 7 rows
Threshold Bit Score: 521.994
Threshold Setting Gi: 254294941
Created: 20-May-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:Fe(II) binding site [ion binding site]
Evidence:
  • Comment:based on similarity to other members of the same protein family

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #                                              #                     
YP_001204443   1 MAKIVGSITTSHVPAIGGAIAKGLQQDPYWKPFFDGFPHVRDWLAkVKPDVVVLVYNDHGLNFFLDKMPTFAIGACESYS 80  Bradyrhizobium ...
ZP_01984563    1 MAKILGGITTSHIPSIGKAIENNLQQTDYWKPLFDAYPPIHHWLDeVQPDVAVVFYNDHGLEFFLDKKPTFAIGAAPSYK 80  Vibrio harveyi ...
YP_496513      1 MAKVIGGYFTSHVPGIGGAIVRGDQETPYWKPFFDGYPPIREWLVeARPDVAIVFSNDHGLNFFLDKMPTFAVGAAERYD 80  Novosphingobium...
YP_001561945   1 MAHLIGGLGTSHIPAIGNAIHKGLQNEPYWKPFFDGFPPIREWLAaQRPDVVVMFYNDHGLNFFLDKMPTFAVGAAERYC 80  Delftia acidovo...
NP_946358      1 MATIIGGLAASHVPAIGGAMAKGLQKDPYWAPFFDGFDAPCRWLEaAKPDAAVVIYNDHGLNFFLDKMPTFAVGAAPEYR 80  Rhodopseudomona...
ZP_01015960    1 MAKILGGITTSHIPAVGNAIQKELYDDPYWKPFFDGYPKVHQWIKdHKPDYCINIYNDHGLGFFLDRMPTFAIGCANEYR 80  Rhodobacterales...
YP_003060964   1 MANIIGAIATSHVPSIGDAIKGNLQGTPKWKGFFDAFPPVHDWLEkKKPDLIVMLYSDHGLNFFLDNRPTFAVGAAPSYG 80  Hirschia baltic...
Feature 1                                                                                        
YP_001204443  81 NADEGWGIPQTAPFKGDSELSWHLIEHLVGEDFDLTTCQEMVVDHAFTLPMALCWPDQK---WPVRVVPVVVNTVQAPLP 157 Bradyrhizobium ...
ZP_01984563   81 NADEGWGIPTIPEINGDPELSWHICNELVENEFDITICQEMKVDHGLTVPMQLMWPNFSy--GHIKVIPVCINVEQHPMP 158 Vibrio harveyi ...
YP_496513     81 NADEGWGLPVYKSFAGHPALSWHLIDSLVRDEFDITTCQKMLVDHAVSIPFELIYPGAEs--WPIKLVPISINTVQYPLP 158 Novosphingobium...
YP_001561945  81 NADEGWGIPTLAPLRGHTELSWHLIESLVGEDFDVVSCQEMLVDHACTLPLKLFWPEGD---CPVAVVPVCINTVQFPLP 157 Delftia acidovo...
NP_946358     81 NDDEGWGIPVMAPFKGDTKLSWHIIETLVESEFDPVTCQEMLVDHAYSLPMELFLRGRA---HDIPTVPVVVNTVQHPLP 157 Rhodopseudomona...
ZP_01015960   81 NEDEGWGLPALDPFPGAPELSWHIAESMVADHFDLTTCQELAVDHGFVVPMQLFWPGAPhhpDMPKTVPISANTVQHPIP 160 Rhodobacterales...
YP_003060964  81 PGDEGFGPPAPREFQGDDVFSWHLIESLVKDEFDIATCQEMKLDHACLLAGDLLWPEQE---WPAKVQPIDINIMQHPVP 157 Hirschia baltic...
Feature 1                                                                                        
YP_001204443 158 SAARCYKLGQALARAIESWpKDERVVVMGTGGLSHQLDGerAGFINKDFDEKFMASMVDDPAWATKYSTTELVELSGTQG 237 Bradyrhizobium ...
ZP_01984563  159 SPKRCFDLGKAIGKAIESYdKDLKVVVLGTGGLSHQLDGerAGFINKEFDLYCMEKLIDDPETLTKLSIYDLVEQGGAQG 238 Vibrio harveyi ...
YP_496513    159 SPKRCLALGRAVGRALQSWaGDERVLICGTGGLSHQLDGprAGFMNPDYDMFCLDNLAANPDALTGHTAEQVAELAGTQG 238 Novosphingobium...
YP_001561945 158 SARRCHALGQAVGRAIARWnSDQRVAVIASGGLSHQLDGerAGFINKAFDLQFLESMATNPEWATQFSMHELVEKTGTQG 237 Delftia acidovo...
NP_946358    158 SLRRCFKLGQAIGRAIESYpEDLKVVVIGTGGLSHQLEGqrAGFINTAFDRRCMDAMTGDIESLLGIDPHELVELAGSQG 237 Rhodopseudomona...
ZP_01015960  161 TLARALDFGKALGKALRSFpEDATVVILGTGGLSHQLDGerAGFINKEFDRYCLDNIVSNPEELTKITRMELVEKAGAQG 240 Rhodobacterales...
YP_003060964 158 SFKRCFKLGQAIGRAIESYpDDLNVAIVASGGLSHQINL--AGFINEDFDRMCLDKIVNAPEDLLDYSIENWVDLAGSQG 235 Hirschia baltic...
Feature 1         #                                        
YP_001204443 238 VELLNWMVARGALPEKVr---KEHANYHIPISNTATGLMVLE 276 Bradyrhizobium sp. ORS278
ZP_01984563  239 AEFIMWLGMRGALTGELn---VLKSSYHAPISNTGAGTMLIE 277 Vibrio harveyi HY01
YP_496513    239 VEILNWIAARGAMGDVPl--hEVSRNYHIPISNTAAASLLLE 278 Novosphingobium aromaticivorans DSM 12444
YP_001561945 238 VELLMWLAMRGALSAAApgvrRVHGNYHIPISNTATALLALE 279 Delftia acidovorans SPH-1
NP_946358    238 VEVMNWVAMRGALTGDVh---ELHRNYHLPISNTASGIMLIE 276 Rhodopseudomonas palustris CGA009
ZP_01015960  241 TEFLMWMMMRGALGDDVn---EITRNYHIPISNTAAGTLLLE 279 Rhodobacterales bacterium HTCC2654
YP_003060964 236 LEFTSWISMRGAMPKEVr---VVTQTYFQPLSNTGGAVLLLE 274 Hirschia baltica ATCC 49814

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap