2J0W,2J0X,2J0X


Conserved Protein Domain Family
ACT_AKiii-LysC-EC_2

?
cd04917: ACT_AKiii-LysC-EC_2 
Click on image for an interactive view with Cn3D
ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII
This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in bacteria (Escherichia coli (EC) LysC). Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The E. coli AKIII (LysC) binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. The second ACT domain (ACT2), this CD, is not involved in the binding of heterotrophic effectors. Members of this CD belong to the superfamily of ACT regulatory domains.
Statistics
?
PSSM-Id: 153189
View PSSM: cd04917
Aligned: 18 rows
Threshold Bit Score: 97.649
Threshold Setting Gi: 76875104
Created: 14-Sep-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interface
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:2J0X; E. coli aspartokinase AKIII dimer, in complex with lysine and aspartate (T-state); contacts of ACT domain 2 from one monomer, with the other monomer at 3.5A.
    View structure with Cn3D
  • Comment:ACT domain 2 does not bind effectors.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ## #####  #   ## ##########                          
2J0W_A      386 LALVALIGNDLSKaCGVGKEVFGVLEPFNIRMICYGASSHNLCFLVPGEDAEQVVQKLHSNLFE 449 Escherichia coli
2J0X_A      386 LALVALIGNDLSKaCGVGKEVFGVLEPFNIRMICYGASSHNLCFLVPGEDAEQVVQKLHSNLFE 449 Escherichia coli
ZP_00157072  58 TEREKLIGNDLHItSGVAKRIFDTVQSYNVRMISYGASTNNVCMLVQSEHSDEIVRSLHKSLFE 121 Haemophilus influenzae R2866
AAU38220    387 LALVALIGNDLHLsAGIAKRIFGTIEEYNIRMISYGASTNNICTLVHSAHADDVVRALHKELFE 450 Mannheimia succiniciproducens MB...
NP_873799   387 LSLLAIIGNDLHLqQGIAKELFQTIEPFNIRLINYGASTNNIYMLVKNSDADHILLALHYDLFE 450 Haemophilus ducreyi 35000HP
YP_155828   383 LSLVAIIGNGIGRdAHISQLTFNTVNDYAVRLICQGASEHNLCFLVADNEGENVIRTLHDRILR 446 Idiomarina loihiensis L2TR
CAH06281    392 MCILSAIGNMQWQcAGFEARIINALATIPIRMISYGSNNNNVSLVIRAEDKREALQRLNDTLFA 455 Bacteroides fragilis NCTC 9343
NP_906237   377 MVIICIVGDMEWDnVGFEARIINALKGVPVRMISYGGSNYNVSVLVKAEDKKKALIALSNKLFN 440 Porphyromonas gingivalis W83
ZP_01042746 397 LTLIALIGNQIGRqSQLSQWVFDAVAPTPVRLICQGASEFNLCFLIPERDTVDVVTRLHERIKR 460 Idiomarina baltica OS145
CAI86325    439 LTLVALIGSEIQL-RQHEMNLMQVLSDFNIRLICHGASKHNLCFLVEQGESDNVVQAIHSRLLE 501 Pseudoalteromonas haloplanktis T...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap