Conserved Protein Domain Family
HTH_SoxR

?
cd01110: HTH_SoxR 
Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator
Helix-turn-helix (HTH) transcriptional regulator SoxR. The global regulator, SoxR, up-regulates gene expression of another transcription activator, SoxS, which directly stimulates the oxidative stress regulon genes in E. coli. The soxRS response renders the bacterial cell resistant to superoxide-generating agents, macrophage-generated nitric oxide, organic solvents, and antibiotics. The SoxR proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the unusually long spacer between the -35 and -10 promoter elements. They also harbor a regulatory C-terminal domain containing an iron-sulfur center.
Statistics
?
PSSM-Id: 133385
View PSSM: cd01110
Aligned: 31 rows
Threshold Bit Score: 208.972
Threshold Setting Gi: 54025303
Created: 30-Apr-2009
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ###             #               ###                                           
Q51506        9 ELSVGELARRAGVAVSALHFYETKGLISSQRNAGNQRRFSRETLRRVVVIKVAQRVGIPLAEIARALQTLPAGRSPSAAD 88  Pseudomonas aeru...
CAA09641     12 ELTVGQLSARSGVAVTALHFYESKGLIKSRRTPGNQRRYTRDTLRRISVIRVAQRMGIPLSTVAEALAELPEERTPTRED 91  Streptomyces vio...
CAC42481     11 DLTVGELSRRSGVPASALRFYEDEGLIHSRRTAGNQRRYRRDTLRRVTFIRMSQRVGMPLSKIREVLGLLSDDRTPTRTD 90  Amycolatopsis me...
AAC69613      5 TITIGRLAKRTGVAASALRFYEARGLIHSVGEAGKTRRYRRDAIRRVSFIRVAQAMGMSLQDIGAALADLPSQRTPTADD 84  Chromobacterium ...
ABK36438      5 WLAIGQIAKRSGVKASALRFYEQKGLIGSVRSEGGQRLYPQDVLRRIAFIRVAQGMGLSLGEIGEALAGLPEGRTPDRRD 84  Aeromonas hydrop...
YP_715786     6 LLTVGELSRRSGFAPSALRFYERQGLLAATRTAGGQRRYERHVLRRLAFIRAATAMGLSLDEVAQALASLPDARTPTKAD 85  Frankia alni ACN14a
YP_165577     6 GLSIGALARRTGLAVSAIRYYETQGLIAPWRNAGGQRRYQRADLRRLSFVMIAQQLGLTLPEIREVLAGLPGNRTPTRGD 85  Silicibacter pom...
YP_762099     8 ILTIGELAARTGVAVSALRYYEERGLVRSLRAKGQHRRFLRSDIRRVSFIRIAQSLGLTIEDVAQAFAALPEGRTPTAAD 87  Hyphomonas neptu...
YP_776017    11 LMSIREVAARSGVPASTLRFYETRGLIKSHRNGSSHRHYSRAVLRLIAFIVFAQKIGYSLDEIAEQLVSLPEDTAPTNKD 90  Burkholderia cep...
ZP_00959087  10 ALSIGSISDRTGLAPSAIRYYEDEGLIAPGRNASGHRRYARSDIRRLSFVQISQGLGFTIAEIREALSSLPADRAPTKAD 89  Roseovarius nubi...
Feature 1                                                                  
Q51506       89 WARLSAQWKEDLTERIDKLLLLRDQLDGCIGCGCLSLQACPLRNPGDQLSAEGPGAHWL 147 Pseudomonas aeruginosa
CAA09641     92 WARLSRRWRADLNERIEQLLALRDGLEDCIGCGCLSVRDCPLTNPYDELGEEGPGPRRL 150 Streptomyces violaceoruber
CAC42481     91 WARISRCWQDDLNARIRQMEQLRDQLDDCIGCGCMSLAKCRLANPGDRLGTDGPGPRRL 149 Amycolatopsis mediterranei
AAC69613     85 WARISQAWKPLLQERIEALCRLRDQLDSCIGCGCLSLERCKLYNPDDKAGEQGCGPRFL 143 Chromobacterium violaceum
ABK36438     85 WDGIASQWQSLLDRRITALQQLQEKLGACIGCGCLSLEHCALYNPDDQAARQGEGPRYL 143 Aeromonas hydrophila subsp. hydrophil...
YP_715786    86 WSAISRRWRTRLDEEIAALEALRDGLDSCIGCGCLSLRRCRISNPADRIGALGPGARAL 144 Frankia alni ACN14a
YP_165577    86 WTRISTALRERLNQRIATLERLRDNLDGCIGCGCLSLPNCALYNPADRVGSKGPGPRLV 144 Silicibacter pomeroyi DSS-3
YP_762099    88 WRAISGDIRGVLDRKIAELENMRDKLDNCIGCGCLSLKRCALYNAGDEAGKTGTGPRFI 146 Hyphomonas neptunium ATCC 15444
YP_776017    91 WQRLSRGWKQRVANRIEELQRLYINLDECIGCGCLSLKRCKLTNPEDRAGRNGPGARRW 149 Burkholderia cepacia AMMD
ZP_00959087  90 WSRISRRFGAELDARIARMQLLRTKLDSCIGCGCLSLKTCALYNPRDRAKRLGSGPRYL 148 Roseovarius nubinhibens ISM

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap