Conserved Protein Domain Family
carboxysome_B

?
TIGR02704: carboxysome_B 
carboxysome peptide B
This model distinguishes one of two closely related paralogs encoded by nearby genes in the carboxysome operons of a number of cyanobacteria and chemoautotrophic bacteria. More distantly related proteins, also belonging to pfam03319, participate in other types of shell such as the ethanolamine degradation organelle. [Central intermediary metabolism, One-carbon metabolism]
Statistics
?
PSSM-Id: 131751
View PSSM: TIGR02704
Aligned: 4 rows
Threshold Bit Score: 146.535
Threshold Setting Gi: 4836665
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD30513  1 MDIMRVVSDLVATRRIPGLQNASLRVLTDAKGRISVAADPVGVPPGKWVIAVSGSAARYAAGDYRILTDLTIAGIIDHWD 80  Acidithiobacillus fe...
AAC32554  1 MEVMRVRSDLIATRRIPGLKNISLRVMEDATGKVSVACDPIGVPEGCWVFTISGSAARFGVGDFEILTDLTIGGIIDHWV 80  Halothiobacillus nea...
AAD02450  1 MEIWRVKDELVCTRRAPGLKSASLRVLQGQTGNIQVATDPVGAPVGKWVFTTLGSAARLAMPDPSVTTDLTICGIIEGWE 80  Thiomonas intermedia...
AAP99601  1 MEIMQVMGRLVCTQRVEGLGHMHLRILRNNKGKQLVAVDPVGAREGNWVFTASGSAARFACPEPSTQTDLTIGGIIDFWT 80  Prochlorococcus mari...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap