Conserved Protein Domain Family
C_P_lyase_phnF

?
TIGR02325: C_P_lyase_phnF 
phosphonates metabolism transcriptional regulator PhnF
All members of the seed alignment for this family are predicted helix-turn-helix transcriptional regulatory proteins of the broader gntR and are found associated with genes for the import and degradation of phosphonates and/or related compounds (e.g. phosphonites) with a direct C-P bond. [Transport and binding proteins, Anions, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131378
View PSSM: TIGR02325
Aligned: 5 rows
Threshold Bit Score: 344.845
Threshold Setting Gi: 27349471
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:BR1100    8 IERNSGVAIWRQIADEIRSDIMAGKLQPGARMPAEIELAEHFGVNRHTVRNAIAALTQEGVLRAEQGRGTFIAnAKRLTN 87  Brucella suis 1330
AAQ59521       2 IERGSGVAVWRQIEETLAADIAAGALHAGQQLPTELQLADRFGVNRHTIRRAVATLVERGLLRVEQGRGTFVQ-DNAIDY 80  Chromobacterium...
BAC46485       5 DTASTGVALWRLVADGIERGIADGRFAAGDKLPGEMEIAETYRVNRHTVRRALAALAERGLVRAERGSGTYVE-AQRIAY 83  Bradyrhizobium ...
P16684         5 THPTSYPTRYQEIAAKLEQELRQ-HYRCGDYLPAEQQLAARFEVNRHTLRRAIDQLVEKGWVQRRQGVGVLVL-MRPFDY 82  Escherichia col...
WP_010970710   7 MKRKNGVALWRQIADRIRGEIAAGDHDETGMLPPEMTLAEKFGVNRHTVRSAIAALASEGILEPMQGRGTMIArKERLSF 86  Agrobacterium f...
tigr:BR1100   88 QCTHPSRISQTFASQTRETKGILLASDLETASPEIASALELETGQEVVRLETLHSADGHPLSRATLWLDAARFPDIAVDY 167 Brucella suis 1330
AAQ59521      81 AISKRTRFSQNMARQNLSSDIDILQSDTMPANAELAGLLQVAVGDTLFRIKVLSKVENRVVDYATMFFPAARLPGLPDAY 160 Chromobacterium...
BAC46485      84 PLRSRTRFSEIVGAGGREPRGQLIEASDDVATRELARELGLKVGAPLVRIEAIRLADRTPICVSTTWLSAELFPGAGSVF 163 Bradyrhizobium ...
P16684        83 PLNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQRF 162 Escherichia col...
WP_010970710  87 PISLRTRFTAGIGDQVKEMEALLLSHTTEPASADLAARLQLPSGAPLVRLETLRKADTRPVSRSTTWFPADRFAGIGEAY 166 Agrobacterium f...
tigr:BR1100  168 AESGSIAVALRKASIEEYFRKSTIISARHADADDRRYLKLSPGAIVLTAQAVKID-TEGRPVQYSLTRFPADRMEFSIEN 246 Brucella suis 1330
AAQ59521     161 LRHRSVTRALDDCGVADYTRRFTRVTARLPDAETVDYLGIPKNRPVLHVKSLNVD-GEGRPVQYGVTCFNGDLVQLVMEQ 239 Chromobacterium...
BAC46485     164 AATRSMTKLLEHFGVRDYRRGATRITAGIVDATDAARLDLPLGRPILVVDATDHG-LDGKPLVTKHSRFAAERVEFLVEN 242 Bradyrhizobium ...
P16684       163 D-SGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRdGESSPAEYSVSLTRADMIEFTMEH 241 Escherichia col...
WP_010970710 167 RKSGSITAAFKALGVADYVRISTVISAIHADTQDLADLELSPGAILLVTQALNAD-MDGVPVQYAVSRFSADTVEFTVEN 245 Agrobacterium f...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap