Conserved Protein Domain Family
hflK

?
TIGR01933: hflK 
HflK protein
HflK and HflC are paralogs encoded by tandem genes in Proteobacteria, spirochetes, and some other bacterial lineages. The HflKC complex is anchored in the membrane and exposed to the periplasm. The complex is not active as a protease, but rather binds to and appears to modulate the ATP-dependent protease FtsH. The overall function of HflKC is not fully described.//Regulation of FtsH by HflKC appears to be negative (SS 8/27/03]
Statistics
?
PSSM-Id: 130988
View PSSM: TIGR01933
Aligned: 8 rows
Threshold Bit Score: 375.201
Threshold Setting Gi: 6647518
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O83151        33 IRIISPTDNGVVTRFGKYHRTLEPGLHYLIPF-VEWVYKVPVTKVQkeefgfrtsksseqshyvnNISHESLMLTGDLNI 111 Treponema palli...
P44546       104 FYTIKEAERGVVLRFGELHSIVQPGLNWKPTF-VDKVLPVNVEQVK-------------------ELRTQGAMLTQDENM 163 Haemophilus inf...
Q8K914        88 FYTIKEAERGVVTTFGKFSHLVAPGLNWRPVF-INEVKAVNVETVR-------------------ELATSGVMLTSDENV 147 Buchnera aphidi...
P25662        97 FYTIKEAERGVVTRFGKFSHLVEPGLNWKPTF-IDEVKPVNVEAVR-------------------ELAASGVMLTSDENV 156 Escherichia coli
Q9KV09        87 FYTIGEAERGVVLRLGKYDRIVDPGLNWRPRF-IDEVTPVNVQAIR-------------------SLRASGLMLTKDENV 146 Vibrio cholerae...
O51221        32 IFIVGPSEEAIVLRLGKLNRTLDSGIHVKIPL-IEEKFIVPVKIVQeikfgflis--psdirendNANDESRIITGDLNI 108 Borrelia burgdo...
WP_010955482 100 VYVVDEQEQAVVLRFGKYYETVGPGLNIYFPP-IDRKYMENVTRER-------------------AYTKQGQMLTEDENI 159 Pseudomonas putida
WP_010892980  65 IQLIGEQQRGVVLRFGQFVRVLQPGLSLKLPWpVESVYKVNATEIK-------------------TFGKQVPVLTRDENI 125 Xylella fastidiosa
O83151       112 VDVEWVVQYRIVDPRAWVFNVESQErrQTIRDISKAVVNSLIGDRAILDIMGPERSAIQMRAKDMMNVLLKRIGLGVLVS 191 Treponema palli...
P44546       164 VKVEMTVQYRVQDPAKYLFSVTNAD--DSLNQATDSALRYVIGHMSMNDILTTGRSVVRENTWKALNEIIKSYDMGLEVI 241 Haemophilus inf...
Q8K914       148 VRVEMNVQYKITDPADYLFSVAYPD--DSLRQATDSALRGVIGHSNMDRVLTEGRTLIRSDTQKEIEETIKPYKLGITIL 225 Buchnera aphidi...
P25662       157 VRVEMNVQYRVTNPEKYLYSVTSPD--DSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMGITLL 234 Escherichia coli
Q9KV09       147 VTVSMDVQYRIADPYKYLYRVTNAD--DSLRQATDSALRAVVGDSLMDSILTSGRQQIRQSTQQTLNQVIDSYDMGLMIV 224 Vibrio cholerae...
O51221       109 INIEWLVQYKIRDPYSFKFKVEDPE--TTIKDIAKSSMNRLIGDNTIFEIINDNRVGITEGVKSSMNEIIDNYNLGIDVV 186 Borrelia burgdo...
WP_010955482 160 VEVPLTVQYKISNLQDFVLNVDQPE--VSLQHATDSALRHVVGSTSMDQVLTEGREQMAVDIRERLQRFLDNYRTGITVT 237 Pseudomonas putida
WP_010892980 126 VNVTLNVQYQINDPHLYLYGSRNAN--EVLVQAAQSAVREQVGRSDLNSVLN-NRGPLSTASKERLQASLDAYRTGLLVT 202 Xylella fastidiosa
O83151       192 SVQLQNVVPPQ-EVQQAFEDVNIAIQDMNRLINEGKESYNREIPKARGDADKLIQEAMGYANERVNRAKGDVARFDSIYA 270 Treponema palli...
P44546       242 DVNFQSARPPE-EVKDAFDDAIKAQEDEQRFIREAEAYAREKEPIARGDAQRILEEATAYKDRIVLDAKGEVERLQRLLP 320 Haemophilus inf...
Q8K914       226 DVNFQTARPPE-EVKEAFDDAIAARENREQYIREAEAYSNEVQPKAHGKAQRILEEAKAYSSRRILEAQGEVVRFLKILP 304 Buchnera aphidi...
P25662       235 DVNFQAARPPE-EVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKAQTILEAQGEVARFAKLLP 313 Escherichia coli
Q9KV09       225 DVNFQSARPPE-QVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKEAQGYNERTINEALGQVAQFEKLLP 303 Vibrio cholerae...
O51221       187 QVQIRNALPPKgKVYEAFEDVNIAIQDKNKYINEGRKEFNQIVPKIKGEALKVIEEARGYKESRINNALADTEIFNAILD 266 Borrelia burgdo...
WP_010955482 238 QVNVQSAAAPR-EVQEAFDDVIRAREDEQRARNQAESYANGVVPEARGQAQRIIEDANGYRDEVIARAKGEADRFTKLLA 316 Pseudomonas putida
WP_010892980 203 GLTLPDARPPE-EVKSAFDEVNGAQQVRERLIDEAQAYAAKVVPEARGRAASNRTAAEGYKQAVIARAQGDADRFTLLQA 281 Xylella fastidiosa
O83151       271 EYVKAPHVTKTRLYLEGLGAILEKTENVLLIDKKLeNLLTLKDIS 315 Treponema pallidum subsp. pallidum str. Nichols
P44546       321 EFKAAPDLLRERLYIQTMEKVMANTPKVMLDGNNG-NNLTVLPLE 364 Haemophilus influenzae Rd KW20
Q8K914       305 EYRKNKEMTLKRLYIESMEKLLSKTKKIFID-KKN-HSKLFLSLN 347 Buchnera aphidicola str. Sg (Schizaphis graminum)
P25662       314 EYKAAPEITRERLYIETMEKVLGNTRKVLVN-DKG-GNLMVLPLD 356 Escherichia coli
Q9KV09       304 EYQAAPKVTRDRLYLDAMEQVYSNTSKVLIDSESS-GNLLYLPID 347 Vibrio cholerae O1 biovar El Tor str. N16961
O51221       267 AYLKNPDITKERLYNETMKEILENKDNIELIDKNFkNFLPFKEVK 311 Borrelia burgdorferi B31
WP_010955482 317 EYRKAPDVTRERLYLETMQEVYSNSSKVMVATKDGqSNLLYLPLD 361 Pseudomonas putida
WP_010892980 282 QYKNAPEVTRKRLWLETIQQVLAQNRKVIGADGRQ---LIYVPIA 323 Xylella fastidiosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap