5UE7,2AMY,6CFV


Conserved Protein Domain Family
PMM

?
pfam03332: PMM 
Click on image for an interactive view with Cn3D
Eukaryotic phosphomannomutase
This enzyme EC:5.4.2.8 is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Statistics
?
PSSM-Id: 397425
Aligned: 9 rows
Threshold Bit Score: 359.39
Threshold Setting Gi: 156087000
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5UE7_B        32 MKKTLE-KLREKVVIGFVGGSDLSKQVEQL----GPNVLNDFDYCFSENGLTAYKLGKELASQSFINWIGNEKYNKLVKF 106 Candida albican...
Q9VTZ6        32 FEEFFYsRVKPRATIGIVGGSDLEKMFEQLn---GRKILNEFDFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINF 108 fruit fly
O80840        29 LLDFIR-ELRKVVTIGVVGGSDLSKISEQL----GKTVTNDYDYCFSENGLVAHKDGKSIGIQSLKLHLGDDKLKELINF 103 thale cress
Q9UTJ2        35 MLETLQ-NLRKVVAIGFVGGSDLSKQQEQLsv-nGENVIDSFDYAFAENGLTAYRYGQQLASQSFIAWLGEEKYQKLVNF 112 Schizosaccharom...
P07283        35 VRKTLA-KLRNKCCIGFVGGSDLSKQLEQL----GPNVLDEFDYSFSENGLTAYRLGKELASQSFINWLGEEKYNKLAVF 109 Saccharomyces c...
2AMY_A        28 xDDFLQ-KLRQKIKIGVVGGSDFEKVQEQLg----NDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINY 102 human
6CFV_A        35 VAAFLQ-KLRSRVQIGVVGGSDYCKIAEQLgd--gDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINF 111 human
Q9XUE6        30 MREFLI-EARKRVPLAIVGGSDFKKITEQLadhdKDLLLSLFDYTFSENGLYGFKGTEPYPVQSIQKAIGDAKLQELINF 108 Caenorhabditis ...
XP_001610907  25 VKDILRrCKLKNFEIAVVSGSKYDKIKGQLn----DGFIDEFDYVFSENGTQVYVKNVLVKSLDITEAIPETKLRKMIEF 100 Babesia bovis T2Bo
5UE7_B       107 ILRYLSDIDLPIRRGTFIEFRNGMINVSPIGRNASTQERNDYEKFDKQHHIRETMVEALKKEFP--DFGLTYSIGGQISF 184 Candida albican...
Q9VTZ6       109 VLRYLSELDVPIKRGTFIEFRNGMMNVCPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFA--DVDLTYSIGGQISF 186 fruit fly
O80840       104 TLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFA--HLNLTFSIGGQISF 181 thale cress
Q9UTJ2       113 CLHYIADLDIPVKRGTFIEFRNGMINISPVGRNANTEERNEFERFDKGRKIRATMVDVLREKFK--DYGLTFSIGGQISF 190 Schizosaccharom...
P07283       110 ILRYLSEIDLPKRRGTFLEFRNGMINVSPIGRNASTEERNEFERYDKEHQIRAKFVEALKKEFP--DYGLTFSIGGQISF 187 Saccharomyces c...
2AMY_A       103 CLSYIAKIKLPKKRGTFIEFRNGXLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFA--GKGLTFSIGGQISF 180 human
6CFV_A       112 CLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFA--GKGLRFSRGGMISF 189 human
Q9XUE6       109 ALRYMSDIQLPVKRGNFVEFRNGMINLSPIGRSCSQEERMQFVEFDKKHGIRQKFTEQLREKFG--QYGLQFAIGGQISV 186 Caenorhabditis ...
XP_001610907 101 SLRYIADLDIPTKRGTFIEHRKSLINICPPGRNSSMDDRRRFVEYDSIHHVRQKFIQVLKSQFDsdDCPLSFVAGGQISI 180 Babesia bovis T2Bo
5UE7_B       185 DVFPTGWDKTYCLQHVEDEH-FENIHFFGDKSYKGGNDYEIYNDPRTIGHAVNSPDDTIRILNETFKL 251 Candida albicans SC5314
Q9VTZ6       187 DVFPHGWDKTYCLRHIEAHYkFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEILEL 254 fruit fly
O80840       182 DVFPKGWDKTYCLQYLED---FSEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTVAKCKALFMS 246 thale cress
Q9UTJ2       191 DVFPAGWDKTYCLQHVEKEG-FDTIHFFGDKTYKGGNDYEIFVDPRTIGHSVTNPDDTIAELKKIFNI 257 Schizosaccharomyces pombe 9...
P07283       188 DVFPAGWDKTYCLQHVEKDG-FKEIHFFGDKTMVGGNDYEIFVDERTIGHSVQSPDDTVKILTELFNL 254 Saccharomyces cerevisiae S288C
2AMY_A       181 DVFPDGWDKRYCLRHVENDG-YKTIYFFGDKTXPGGNDHEIFTDPRTXGYSVTAPEDTRRIC-ELLFS 246 human
6CFV_A       190 DVFPEGWDKRYCLDSLDQDS-FDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFP 256 human
Q9XUE6       187 DVFPTGWDKTFCLQYLVPD--FDTIHFFGDKTAPGGNDHEIFADERTVGHTVEGPEDTRKHVENVLKE 252 Caenorhabditis elegans
XP_001610907 181 DVYPKAWSKSIALSHIEK---CDVIHFFGDNTREGGNDFEIYNHPDVIGHTVTGYKDLVNQLEELLAk 245 Babesia bovis T2Bo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap