NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, May 21, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS19533.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19533.1 Public Mus musculus 5 Chek2 23 108 98 CCDS HistoryNCBI Gene:50883Re-query CCDS DB by CCDS ID:19533.1Re-query CCDS DB by GeneID:50883See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19533.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000066160.2 ENSMUSP00000066679.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066160.2Link to Ensembl Protein Viewer:ENSMUSP00000066679.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000066160Re-query CCDS DB by Protein ID:ENSMUSP00000066679
Original member Current member NCBI NM_016681.4 NP_057890.1 Accepted alive Link to Nucleotide Sequence:NM_016681.4Link to Protein Sequence:NP_057890.1Re-query CCDS DB by Nucleotide ID:NM_016681Re-query CCDS DB by Protein ID:NP_057890Link to BLAST:NP_057890.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057890.1 546 Q9Z265 546 100% 0 0

Chromosomal Locations for CCDS 19533.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 110841213 110841543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110848389 110848513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110848630 110848777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110849596 110849686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110855725 110855833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110858374 110858427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110860863 110860924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110863258 110863357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110865522 110865608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110866263 110866426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110866938 110867053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110868008 110868093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110872027 110872107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110873480 110873566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1641 nt):
ATGAAGAGTCATCATCAGTCCCACAGCAGCACCTCCTCGAAGGCTCATGACAGTGCTTCCTGTTCACAGT
CC
CAGGGTGGCTTCAGCCAGCCCCAAGGCACTCCTTCTCAGTTGCACGAGCTCTCACAGTATCAGGGTTC
G
TCCAGCTCCTCTACCGGCACAGTGCCGTCCTCCAGCCAGTCCTCGCACTCCAGTTCTGGGACTCTGAGC
TCG
CTGGAGACAGTGTCTACCCAGGAACTCTGTTCTATTCCTGAGGACCAAGAACCTGAAGAACCTGGTC
CT
GCCCCTTGGGCTCGGCTATGGGCTCTTCAGGATGGATTCTCCAATCTAGACTGTGTTAACGACAACTA
C
TGGTTTGGGAGAGATAAAAGCTGTGAATATTGCTTCGATGGACCACTGTTGAGAAGGACGGACAAGTAC
CGG
ACTTACAGCAAGAAGCATTTTCGTATTTTCAGGGAAATGGGCCCTAAAAATTGTTACATCGTATACA
TA
GAGGATCACAGTGGAAATGGAACCTTCGTAAATACCGAGCTTATTGGGAAAGGCAAACGCTGTCCTCT
G
AGTAACAACTCTGAAATCGCACTTTCACTATGTAGAAATAAAGTTTTTGTATTTTTTGATCTGACTGTA
GAT
GATCAGTCAGTTTATCCTAAGGAATTAAGAGACGAATACATCATGTCAAAAACTCTTGGAAGTGGTG
CG
TGTGGGGAGGTAAAGATGGCTTTTGAGAGGAAGACATGTCAGAAAGTGGCCATAAAGATCATTAGCAA
G
CGGAGGTTTGCTCTTGGCTCATCGAGAGAAGCCGACACAGCTCCCAGTGTGGAAACTGAAATAGAAATT
TTG
AAGAAACTAAATCATCCATGCATCATCAAGATTAAAGATGTTTTTGATGCGGAAGATTATTACATTG
TT
CTGGAACTGATGGAAGGAGGAGAACTATTTGACCGGGTGGTGGGGAACAAGCGCCTGAAAGAAGCCAC
C
TGTAAGCTCTACTTCTACCAGATGCTTGTAGCTGTACAGTACCTTCACGAAAATGGGATCATACATCGG
GAC
TTAAAGCCGGAGAATGTTCTTTTATCATCTCAGGAAGAGGATTGTCTAATCAAGATCACTGACTTTG
GG
CAGTCCAAGATCTTGGGGGAGACCTCCTTGATGAGAACCTTATGTGGTACGCCCACTTATCTGGCTCC
T
GAGGTTCTTGTCTCCAACGGGACTGCTGGGTACAGCCGCGCTGTGGACTGCTGGAGTTTAGGAGTTATT
CTT
TTCATCTGCCTAAGTGGGTATCCACCTTTCTCTGAGCATAAGACCCAAGTGTCCCTGAAGGATCAGA
TC
ACCAGTGGAAAGTACAACTTTATTCCTGAAGTCTGGACAGATGTCTCAGAGGAGGCTCTGGACCTTGT
C
AAGAAACTGTTAGTTGTAGACCCAAAGGCTCGGCTTACCACAGAGGAGGCCTTAAATCATCCGTGGCTT
CAG
GATGAGTACATGAAGAAGAAATTTCAGGATCTCCTGGTGCAGGAAAAGAACTCGGTGACCCTCCCTG
TG
GCTCCCGCCCAGACTTCCAGTCAAAAGCGGCCCCTGGAACTGGAGGTGGAGGGTATGCCGAGCACAAA
A
CGCCTGTCTGTGTGTGGGGCTGTGTTGTGA


Translation (546 aa):
MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQSSHSSSGTLS
S
LETVSTQELCSIPEDQEPEEPGPAPWARLWALQDGFSNL
DCVNDNYWFGRDKSCEYCFDGPLLRRTDKY
R
TYSKKHFRIFR
EMGPKNCYIVYIEDHSGNGTFVNTELIGKGKRCPLSNNSEIALSLCRNKVFVFFDLTV
D
DQSVYPKELRDEYIMSKTLG
SGACGEVKMAFERKTCQKVAIKIISKRRFALGSSREADTAPSVETEIEI
L
KKLNH
PCIIKIKDVFDAEDYYIVLELMEGGELFDRVVGNKRLKEATCKLYFYQMLVAVQYLHENGIIHR
D
LKPENVLLSSQEEDCLIK
ITDFGQSKILGETSLMRTLCGTPTYLAPEVLVSNGTAGYSRAVDCWSLGVI
L
FI
CLSGYPPFSEHKTQVSLKDQITSGKYNFIPEVWTDVSEEALDLVKKLLVVDPKARLTTEEALNHPWL
Q
DEYMKKKFQDLLVQEKNSVTLPVAPAQTSSQKRPLELEVEGMPSTKRLSVCGAVL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser