NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS1126.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1126.1 Public Homo sapiens 1 SSR2 24 110 108 CCDS HistoryNCBI Gene:6746Re-query CCDS DB by CCDS ID:1126.1Re-query CCDS DB by GeneID:6746See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 1126.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000295702.9 ENSP00000295702.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000295702.9Link to Ensembl Protein Viewer:ENSP00000295702.4Re-query CCDS DB by Nucleotide ID:ENST00000295702Re-query CCDS DB by Protein ID:ENSP00000295702
Original member Current member EBI ENST00000480567.5 ENSP00000434306.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000480567.5Link to Ensembl Protein Viewer:ENSP00000434306.1Re-query CCDS DB by Nucleotide ID:ENST00000480567Re-query CCDS DB by Protein ID:ENSP00000434306
Original member Current member NCBI NM_003145.4 NP_003136.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003145.4Link to Protein Sequence:NP_003136.1Re-query CCDS DB by Nucleotide ID:NM_003145Re-query CCDS DB by Protein ID:NP_003136Link to BLAST:NP_003136.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003136.1 183 P43308 183 100% 0 0

Chromosomal Locations for CCDS 1126.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 156009540 156009650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156011810 156011887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156014961 156015069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156018270 156018368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 156020013 156020167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (552 nt):
ATGAGGCTGCTGTCATTTGTGGTGTTGGCTCTATTTGCTGTCACTCAAGCAGAGGAAGGAGCCAGGCTTT
TG
GCTTCCAAATCACTGCTGAACAGATACGCCGTGGAGGGACGAGACCTGACCTTGCAGTACAACATCTA
C
AATGTTGGCTCAAGTGCTGCATTAGACGTGGAACTATCTGATGATTCCTTCCCTCCAGAAGACTTTGGC
ATT
GTGTCTGGAATGCTCAATGTCAAATGGGACCGGATTGCCCCTGCTAGCAATGTCTCCCACACTGTGG
TC
CTGCGCCCTCTCAAGGCTGGTTATTTCAACTTCACCTCGGCAACAATTACTTACCTGGCCCAGGAGGA
T
GGGCCCGTTGTGATTGGCTCTACCAGTGCACCTGGACAGGGAGGAATCCTGGCTCAGCGGGAGTTTGAC
AGG
CGATTCTCCCCTCATTTTCTGGACTGGGCAGCCTTTGGGGTCATGACCCTTCCCTCCATCGGCATCC
CC
CTGCTATTGTGGTACTCCAGCAAGAGGAAATATGACACTCCCAAAACGAAGAAGAACTGA


Translation (183 aa):
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFG
I
VSGMLNVKWDRIA
PASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFD
R
RFSPHF
LDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser