NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8456.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8456.1 Public Homo sapiens 11 HEPACAM 22 109 92 CCDS HistoryNCBI Gene:220296Re-query CCDS DB by CCDS ID:8456.1Re-query CCDS DB by GeneID:220296See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8456.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000298251.4 ENSP00000298251.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000298251.4Link to Ensembl Protein Viewer:ENSP00000298251.4Re-query CCDS DB by Nucleotide ID:ENST00000298251Re-query CCDS DB by Protein ID:ENSP00000298251
Original member NCBI NM_152722.4 NP_689935.2 Updated not alive Link to Nucleotide Sequence:NM_152722.4Link to Protein Sequence:NP_689935.2Re-query CCDS DB by Nucleotide ID:NM_152722Re-query CCDS DB by Protein ID:NP_689935
Current member NCBI NM_152722.5 NP_689935.2 Accepted alive Link to Nucleotide Sequence:NM_152722.5Link to Protein Sequence:NP_689935.2Re-query CCDS DB by Nucleotide ID:NM_152722Re-query CCDS DB by Protein ID:NP_689935Link to BLAST:NP_689935.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_689935.2 416 Q14CZ8-1 416 100% 0 0

Chromosomal Locations for CCDS 8456.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 124921138 124921440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124922388 124922458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124922745 124922818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124923340 124923433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124923729 124924010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124924728 124925069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 124935922 124936006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1251 nt):
ATGAAGAGAGAAAGGGGAGCCCTGTCCAGAGCCTCCAGGGCCCTGCGCCTTGCTCCTTTTGTCTACCTTC
TT
CTGATCCAGACAGACCCCCTGGAGGGGGTGAACATCACCAGCCCCGTGCGCCTGATCCATGGCACCGT
G
GGGAAGTCGGCTCTGCTTTCTGTGCAGTACAGCAGTACCAGCAGCGACAGGCCTGTAGTGAAGTGGCAG
CTG
AAGCGGGACAAGCCAGTGACCGTGGTGCAGTCCATTGGCACAGAGGTCATCGGCACCCTGCGGCCTG
AC
TATCGAGACCGTATCCGACTCTTTGAAAATGGCTCCCTGCTTCTCAGCGACCTGCAGCTGGCCGATGA
G
GGCACCTATGAGGTCGAGATCTCCATCACCGACGACACCTTCACTGGGGAGAAGACCATCAACCTTACT
GTA
GATGTGCCCATTTCGAGGCCACAGGTGTTGGTGGCTTCAACCACTGTGCTGGAGCTCAGCGAGGCCT
TC
ACCTTGAACTGCTCACATGAGAATGGCACCAAGCCCAGCTACACCTGGCTGAAGGATGGCAAGCCCCT
C
CTCAATGACTCGAGAATGCTCCTGTCCCCCGACCAAAAGGTGCTCACCATCACCCGCGTGCTCATGGAG
GAT
GACGACCTGTACAGCTGCATGGTGGAGAACCCCATCAGCCAGGGCCGCAGCCTGCCTGTCAAGATCA
CC
GTATACAGAAGAAGCTCCCTTTACATCATCTTGTCTACAGGAGGCATCTTCCTCCTTGTGACCTTGGT
G
ACAGTCTGTGCCTGCTGGAAACCCTCCAAAAGGAAACAGAAGAAGCTAGAAAAGCAAAACTCCCTGGAA
TAC
ATGGATCAGAATGATGACCGCCTGAAACCAGAAGCAGACACCCTCCCTCGAAGTGGTGAGCAGGAAC
GG
AAGAACCCCATGGCACTCTATATCCTGAAGGACAAGGACTCCCCGGAGACCGAGGAGAACCCGGCCCC
G
GAGCCTCGAAGCGCGACGGAGCCCGGCCCGCCCGGCTACTCCGTGTCTCCCGCCGTGCCCGGCCGCTCG
CCG
GGGCTGCCCATCCGCTCTGCCCGCCGCTACCCGCGCTCCCCAGCGCGCTCCCCAGCCACCGGCCGGA
CA
CACTCGTCGCCGCCCAGGGCCCCGAGCTCGCCCGGCCGCTCGCGCAGCGCCTCGCGCACACTGCGGAC
T
GCGGGCGTGCACATAATCCGCGAGCAAGACGAGGCCGGCCCGGTGGAGATCAGCGCCTGA


Translation (416 aa):
MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQ
L
KRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLT
V
D
VPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLME
D
DDLYSCMVENPISQGRSLPVKITVY
RRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQNSLE
Y
MDQNDDRLKPE
ADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSPAVPGRS
P
GLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser