1UJS,1YU8,2K6M,1QZP,1UND


Conserved Protein Domain Family
VHP

?
smart00153: VHP 
Click on image for an interactive view with Cn3D
Villin headpiece domain
Statistics
?
PSSM-Id: 128458
View PSSM: smart00153
Aligned: 20 rows
Threshold Bit Score: 56.1733
Threshold Setting Gi: 253723149
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UJS_A    47 HLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF 82   human
AAC31607 931 YLSEVEFKTVFGMEKESFYKLPGWKQDLLKKKFNLF 966  thale cress
CAA73320 939 YLSSEEFKEKFGMTKEAFYKLPKWKQNKFKMAVQLF 974  thale cress
AAC31605 875 YLTEKEFEERFGMAKSEFYALPKWKQNKLKISLHLF 910  thale cress
I39062   370 HLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF 405  human
BAA74866 648 HLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF 683  human
Q23989   852 HLTHDDFVSVFNMSFYEFDELPKWKKMELKKQFKLF 887  fruit fly
BAA06681 427 HLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 462  human
P36418   924 YLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF 959  Dictyostelium discoideum
1QZP_A    33 HLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF 68   human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap