Conserved Protein Domain Family

smart00153: VHP 
Click on image for an interactive view with Cn3D
Villin headpiece domain
PSSM-Id: 128458
Aligned: 20 rows
Threshold Bit Score: 56.1733
Threshold Setting Gi: 253723149
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P36418   924 YLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF 959  Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap