Conserved Protein Domain Family
PTH

?
smart00087: PTH 
Parathyroid hormone
Statistics
?
PSSM-Id: 128398
View PSSM: smart00087
Aligned: 13 rows
Threshold Bit Score: 62.9735
Threshold Setting Gi: 163647
Created: 13-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001076188  35 KRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA 70  rabbit
XP_002822054  62 KRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 97  Sumatran orangutan
EAW68494      62 KRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 97  human
XP_002755112  30 KRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 65  white-tufted-ear marmoset
NP_058740     30 KRAVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF 65  Norway rat
NP_001003302  30 KRSVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 65  dog
AAA30749      30 KRAVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 65  cattle
NP_990669     36 KRAVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTA 71  chicken
NP_999566     30 KRSVSEIQLMHNLGKHLSSLERVEWLRKKLQDVHNF 65  pig
ADK36630      35 KRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA 70  goat
P58073        35 KRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA 70  cattle
NP_777178     35 KRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA 70  cattle
NP_990783     30 KRSVSEMQLMHNLGEHRHTVERQDWLQMKLQDVHSA 65  chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap