Conserved Protein Domain Family
DUF2717

?
pfam10911: DUF2717 
Protein of unknown function (DUF2717)
Members in this family of proteins are annotated as gene 6.5 protein however currently there is no known function.
Statistics
?
PSSM-Id: 151358
Aligned: 4 rows
Threshold Bit Score: 124.535
Threshold Setting Gi: 75086333
Created: 21-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q859F4    1 MLKVIQHHIQNPDDIPDIAPAAAEYLAVRLNASYLIATGIVDDLRKQGYSEGYIAGFLDGANAAveiTELMQEAQ-LQKE 79  Pseudomonad phage gh-1
AIM41085  1 MLTPINQLLKNPNDIPDVPRATAEYLQVRFNYAYLEASGHIGLMRANGCSEAHILGFIQGLQYA---SNVIDEIE-LRKE 76  Escherichia phage CI...
Q9T113    1 MLQPINHVLTHPDDIPSMPRAAKEYLQVRFNQTYVMESGEYRALRAAGYSESFIAGVMHGLYLA---SRTLDEIE-VRKE 76  Yersinia phage phiYe...
APD19641  1 MLTPIKKYMENPQDIPNVPRSVMEYLQVQYNAGYAIQSGLINRLKQAGWSESYIAGFLAGLNYA---SQTLDDMEaIRKE 77  Pectobacterium phage...
Q859F4   80 E 80  Pseudomonad phage gh-1
AIM41085 77 Q 77  Escherichia phage CICC 80001
Q9T113   77 Q 77  Yersinia phage phiYeO3-12
APD19641 78 Q 78  Pectobacterium phage PP74
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap