1T4W


Conserved Protein Domain Family
CEP1-DNA_bind

?
pfam09287: CEP1-DNA_bind 
Click on image for an interactive view with Cn3D
CEP-1, DNA binding
Members of this family of DNA-binding domains are found the transcription factor CEP-1. They adopt a beta sandwich structure, with nine strands in two beta-sheets, in a Greek-key topology.
Statistics
?
PSSM-Id: 401285
View PSSM: pfam09287
Aligned: 2 rows
Threshold Bit Score: 368.96
Threshold Setting Gi: 51247555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T4W_A   1 EKWMEIDVLKQKVAKSSDMAFAISSEHEKYLWTKMGCLVPIQVKWKLDKRHfnSNLSLRIRFVKYDKKENVEYAIRNPrS 80  Caenorhabditis elegans
A8WW61 238 EEWLTFEVKKERASKVSDFEFETVVNDGIYLWAKMKCNIPFIVKWNVSSCH--KQLFLKVRLVNYMASDNIENSIRVP-S 314 Caenorhabditis briggsae
1T4W_A  81 DVMKCRSHTEREQHFPFDSFFYIRNSEHEFS--YSAEKGSTFTLIMYPGAVQANFDIIFMCQEKCLDLDDRRKTMCLAVF 158 Caenorhabditis elegans
A8WW61 315 NLAKCHNHRMTEEKTPRESFFYVVKSGEHWTpqINSKKDQCFVAKLAPGTTQVLFDLIFKCQRSCLDLAERRKRMCLAVF 394 Caenorhabditis briggsae
1T4W_A 159 LDDENGNEILHAYIKQVRIVAYPRRDWKNFCEREDAKQ 196 Caenorhabditis elegans
A8WW61 395 LEDENGNELLHDVIKQLLIVGYPRRDWKNFCEKRGDFK 432 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap