2PK8


Conserved Protein Domain Family
DUF1884

?
pfam08967: DUF1884 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1884)
This domain is found in a set of hypothetical bacterial proteins. It shows similarity to the N-terminus of ATP-synthase.
Statistics
?
PSSM-Id: 370216
View PSSM: pfam08967
Aligned: 4 rows
Threshold Bit Score: 102.688
Threshold Setting Gi: 48429184
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PK8_A  12 RGDLIRILGEIEEKMNELKMDGFNPDIILFGREAYNFLSNLLKKEMEEEGPFTHVSNIKIEILEELGGDAVVIDSKVLGL 91  Pyrococcus furiosus D...
Q5JFJ5   6 RGDLIRILSSVEEKANELKLEGFEPDVVLVGKEAYEFIKEQVNEEFGGEEEVFELSGLRVRILEELGGDAVVVDTKALGY 85  Thermococcus kodakare...
P61996   4 NNIMSQVKEIIEAAIKELEDDGFEPDIILAGPIFIRYLPEDVR--------------LKVYEIEELGSDAIIADSKYLGQ 69  Pyrococcus furiosus D...
Q5JEV9   1 mppMSEILEVIERIIGELRSEGMNPNIMLAGPQFIEYSKDALKQ-----------INLKIYRIEELGYDAVIADSNYLGQ 69  Thermococcus kodakare...
2PK8_A  92 VPgAAKRIKIIK 103 Pyrococcus furiosus DSM 3638
Q5JFJ5  86 AP-ATRRFKVVP 96  Thermococcus kodakarensis KOD1
P61996  70 IKkAAKRISIDP 81  Pyrococcus furiosus DSM 3638
Q5JEV9  70 IKkASRRVSVEP 81  Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap