5M88,3JB9


Conserved Protein Domain Family
Prp19

?
pfam08606: Prp19 
Click on image for an interactive view with Cn3D
Prp19/Pso4-like
This regions is found specifically in PRP19-like protein. The region represented by this family covers the sequence implicated in self-interaction and a coiled-coiled motif. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly.
Statistics
?
PSSM-Id: 400774
View PSSM: pfam08606
Aligned: 76 rows
Threshold Bit Score: 74.088
Threshold Setting Gi: 122058252
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5M88_A        69 TSIPSLLKAFQDEWDALVLETYTTREQLARVREELATALYQHDAAVRVIARLTRERDEAREALAR 133 Chaetomium thermophilum var. t...
CCD24805      75 YSIPNLLSTLQNEWDAIMLENFKLRKQLDSLTKQYSTALYERDAAKNVATRIMKEKNQLTKDLQN 139 Naumovozyma dairenensis CBS 421
CCF60632      75 YSVPNLLSTLQNEFDAIMLENFKLRKTLDIMSKKLSTALYERDAAKLVAANLLNEKKTTLEDitm 139 Kazachstania africana CBS 2517
CCC70702      75 YSIPNLLSTLQNEWDAIMLENFKLRKANDELAKNLSTALYEIDAAKIVAAKAMKERDQIIQELNE 139 Naumovozyma castellii CBS 4309
CCE93540      75 YSIPNLLSSLQNEWDAVMLENFKLRKQLNQCTKQLSTALYQRDAAKIVATKAMAANEGLKRELAQ 139 Torulaspora delbrueckii
CAR29405      75 YSIPNLLSSLQNEWDAIMLENFRLRKQLDAFTKQLSTALYERDAAKIVASNALREREQLVQELNQ 139 Zygosaccharomyces rouxii
XP_002553738  75 YSIPNLLSALQDEWDAVMLENFQLRQQIEASKKELSTALYRCDAAMNVAARATMEADKLKQELNi 139 Lachancea thermotolerans CBS 6340
XP_001566022  72 ASVPTLLERLQVEWEGVALEQFSLRQQVTQLQLELAHALQQYDAACRVIARLSKELDSHRGGkam 136 Leishmania braziliensis MHOM/B...
Q585U7        67 ETVPALLAKLHSQWDAIMLEQFALRQQLTQTQQELAQALHQYEAACRVIATFLSDGKAEEDTRVv 131 Trypanosoma brucei
XP_001315681  68 SSFGDCLSGLQNQWNILQKELFETRKKLGQCERELAQALYEKEAAKRIIARLITENPDQIAIhqv 132 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap