5MQF


Conserved Protein Domain Family
Prp19

?
pfam08606: Prp19 
Click on image for an interactive view with Cn3D
Prp19/Pso4-like
This regions is found specifically in PRP19-like protein. The region represented by this family covers the sequence implicated in self-interaction and a coiled-coiled motif. PRP19-like proteins form an oligomer that is necessary for spliceosome assembly.
Statistics
?
Aligned: 88 rows
Threshold Bit Score: 55.6018
Threshold Setting Gi: 397632563
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MQF_G    69 TSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREA 130 human
EAY03458  68 SSFGDCLSGLQNQWNILQKELFETRKKLGQCERELAQALYEKEAAKRIIARLITENPDQIAI 129 Trichomonas vaginalis G3
EAY03011  68 YSFGDYLLSLQNQWNSKQKELYETRKKLAQCERELAQALYETEAAKRVIARILSNEGERIYI 129 Trichomonas vaginalis G3
Q585U7    67 ETVPALLAKLHSQWDAIMLEQFALRQQLTQTQQELAQALHQYEAACRVIATFLSDGKAEEDT 128 Trypanosoma brucei
CAM45546  72 ASVPTLLERLQVEWEGVALEQFSLRQQVTQLQLELAHALQQYDAACRVIARLSKELDSHRGG 133 Leishmania braziliensis MHOM/BR/75/M2904
CCD24805  75 YSIPNLLSTLQNEWDAIMLENFKLRKQLDSLTKQYSTALYERDAAKNVATRIMKEKNQLTKD 136 Naumovozyma dairenensis CBS 421
CCC70702  75 YSIPNLLSTLQNEWDAIMLENFKLRKANDELAKNLSTALYEIDAAKIVAAKAMKERDQIIQE 136 Naumovozyma castellii CBS 4309
CCE93540  75 YSIPNLLSSLQNEWDAVMLENFKLRKQLNQCTKQLSTALYQRDAAKIVATKAMAANEGLKRE 136 Torulaspora delbrueckii
CAR29405  75 YSIPNLLSSLQNEWDAIMLENFRLRKQLDAFTKQLSTALYERDAAKIVASNALREREQLVQE 136 Zygosaccharomyces rouxii
CAR23301  75 YSIPNLLSALQDEWDAVMLENFQLRQQIEASKKELSTALYRCDAAMNVAARATMEADKLKQE 136 Lachancea thermotolerans CBS 6340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap