Conserved Protein Domain Family
DUF1084

?
pfam06454: DUF1084 
Protein of unknown function (DUF1084)
This family consists of several hypothetical plant specific proteins of unknown function.
Statistics
?
PSSM-Id: 399452
View PSSM: pfam06454
Aligned: 17 rows
Threshold Bit Score: 308.878
Threshold Setting Gi: 122056956
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDP05347      25 FPDWWKKAEQNEAFQTYSNYGIGAAYGLIGLVAFVQLLRLQLRVPEYGWTTQKVFHLLNCLVSVLRCSVFFFRPALEGLH 104 Chlamydomonas r...
Q6EU03        11 GAGWWDLVNGSTAWQDGIFLSLAALYGLVAASSFIQVVRIQYRVPEYGWTTQKVFQLLNFIVNGARCSIFAVRRQVQQVN 90  Japanese rice
XP_001778362  21 IMDWWRRVDSSVLWQERIWLGLAIAYAVIAVIALVQLIRIELRVPEYGWTTQKVFHLLNFIVNGVRAAVFCFREDVQALS 100 Physcomitrella ...
EFJ23006      13 AEDWWYTLNESKAWQNRFYYSLSGAYLLVALVALIQLIRIEIRVPEYGWTTQKVFHLLNFLVNGVRAVVFFFRRQVQFLE 92  Selaginella moe...
XP_002979144  25 AKDWWEELNRSKSWQDGVFYALAALYAAIAIVALVQLIRIHRRVRDYGWTTQKVFHLLNFLVCAVRASVFLFRRPAQHVG 104 Selaginella moe...
XP_011626514  41 ASDWWDEVQNSQKWQDGIFYALCAAYSAVAAVALIQLFRIQLRVPEYGWTTQKVFHLMNFIVNGLRAILFGFYRSVFLLK 120 Amborella trich...
XP_009419586 109 VQNWWDEMNDSSKWQDVVFYFLCAAYSLVSAVALIQVVRIQLRVPEYGWTTQKVFHFMNFIVNGVRAVVFGFHKNVFLFR 188 wild Malaysian ...
ERN19596      12 LQSWWTEINESSSWQDGIFFFLCAAYALVSAVALIQLIRIELRVPEYGWTTQKVFHFMNFIVNGVRAVVFGFHHQVFSFE 91  Amborella trich...
EER97820      26 LRGWWDDVNESPQWQDAAFFSLAAAYALVSAVALIQLIRIQRRVPEFGWTTQKVFHLMNFLVNGVRALVFGFHAHVFLLH 105 sorghum
Q9FEG2        20 ITSWWDDVNESTQWQDGIFFALCGAYALVSAVALVQLIRIQMRVPEYGWTTQKVFHLMNFVVNGVRAVLFGFHMQVFLVH 99  thale cress
EDP05347     105 PVVTKLMLLDLPGLLFFTTYTLLVLFWAEIYQQARNLPAAALRPTFLIINIVVYAVLAGLWALNAFGRTgdiqELAYTVS 184 Chlamydomonas r...
Q6EU03        91 PEIFQHVILDLPGLAFFTTYAMLALFWAEISYQARGLETEGLRSGFYTINGVIYVIQVLLWALLWHNPN----PSMIVLS 166 Japanese rice
XP_001778362 101 PEILQHVLLDLPGILFFTTYTLLVLFWAEIYHQARSLSTDSLRPTFLITNAVIYLVQTFIWGYLYWSPS----VLVMSVA 176 Physcomitrella ...
EFJ23006      93 PRILQSLLLDLPGLLFFTTYTLLVLFWAEIYHQARSLPTDNLRPTFVVINTIIYTIQILVWLIVWWKPL----GLLESFS 168 Selaginella moe...
XP_002979144 105 PHILQSFLLDLPGLLFFSTYTLLVLFWAEIFYQALSLPTENLRPSFLIINTAIYVFQIAIWLIQWWDPM----LVWDIFS 180 Selaginella moe...
XP_011626514 121 PKVLQMVLLELPGLLFFSTYTLLVLFWAEIYHQARSLRIDRLRPAYLMINGAIYLLQVCIWIYVRVSPN----AVALEIA 196 Amborella trich...
XP_009419586 189 PRVFTLVLLDLPGILFFSTYTLLVLFWAEIYHQARSLPSDKLRIIYIIVNCGIYVIQVCIWIYLWIHDN----RIVESIG 264 wild Malaysian ...
ERN19596      92 PKVFRLVLLDLPVMLFFSTYTLLVLFWAEIYHQARSLPTDKLRIVYISINGGIYFIQVCIWIYLWIDDN----VVVESIG 167 Amborella trich...
EER97820     106 TKVYKLVLLDLPGLLFFSTYTLLVLFWAEIYHQARSLPTDKLRPAYIAVNTIIYVVQVCIWIYLGINDN----AVIELAS 181 sorghum
Q9FEG2       100 PKALCWVLLDLPGLLFFSAYTLLVLFWAEIYHQARSLPTDKLRITYISVNVAVYLAQIGIWAYIWVHDN----STVELVG 175 thale cress
EDP05347     185 NLWLAAVFLAAAAGFLLYGGRLFVMLQRFPIESRGRRKKLREVGLVTSICAGCFTFRALMIATAAVDRdDLEVDMLGHPL 264 Chlamydomonas r...
Q6EU03       167 KLFIAGLSFSAALGFLLYGGRLFFMLKRFPIESKGRQKKLREVGRVATICFLCFLARCIMMCFDAFDK-KADLDVLDHPI 245 Japanese rice
XP_001778362 177 KFFFAAVSLMAALGFLLYGGKLFLMLRRFPIESKGRRKKLREVGCVTAICFICFTIRSFIMTFSVFNK-AIDLDVLYHPI 255 Physcomitrella ...
EFJ23006     169 KIFFAGVSLGAAIGFLLYGGRLFLMLQRFPIESKGRRKKLREVGLVTAICFTCFTIRSGIMAWAAFDK-RGDLDVLDHPV 247 Selaginella moe...
XP_002979144 181 RVFFAGVSFAGALGFLLYGGRLFLMLRRFPIESKGRRKKLREVGCVTAICFTCFTIRSVVVAWSAFDK-KAEIDVLYHPI 259 Selaginella moe...
XP_011626514 197 KLFFAVVSFFAALGFLLYGGRLFFMLRRFPIESKGRRKKLNEVGFVTAICCTCFLIRCFMVAFSAFDK-DVDLDVLNHPI 275 Amborella trich...
XP_009419586 265 SIFVAVLSFIAAVGFILYGGRLFCMLRQFPIESKGRQKKLHEVGSVTAICFTCFLVRCCVVGLSAFDT-DMSLDVLNHPI 343 wild Malaysian ...
ERN19596     168 SLFIAAISFFAALGFLLYGGRLFLMLRRFPIESKGRRKKLHEVGSVTVICFICFLIRCFVDAWSAFDS-HLSLDVMDHPI 246 Amborella trich...
EER97820     182 KIFIVAVSFIALLGFSVYGGRLFVLLRRFPIESKGRQKKLYEVGTVTAICVTCFLIRCVVVALSAFDA-DVSLEVLDHPI 260 sorghum
Q9FEG2       176 KIFIAVVSFIAALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCVVVAVSAFDK-DLTLDVLDHPV 254 thale cress
EDP05347     265 LNIAYYGLAEILPSAAVLYILRKLPPKRQNAQGYQ 299 Chlamydomonas reinhardtii
Q6EU03       246 LNFIYYLIVEILPSSLVLFILRRIPSKLRLAQYHP 280 Japanese rice
XP_001778362 256 LNAIYYTLVEIVPSALVLYILRKLPPKRLSGQYHP 290 Physcomitrella patens
EFJ23006     248 LDTVVYLLVEILPSALVLYILRKLPPNRpgppgye 282 Selaginella moellendorffii
XP_002979144 260 LNFLYFLLVEILPSALVLYILRKLPAKRATSTAYK 294 Selaginella moellendorffii
XP_011626514 276 LNLIYYTLVEIVPSALVLFILRKLPPKRVSDQYHP 310 Amborella trichopoda
XP_009419586 344 LDLIYYTLTEILPSVLVLYILRKLPPRRVSGQYHP 378 wild Malaysian banana
ERN19596     247 LNLIYYLLAEIVPSALVLYILRKLPPKRISGQYHP 281 Amborella trichopoda
EER97820     261 LDFFYYMFAEILPSALVLFVLRKLPPKRVSAQYHP 295 sorghum
Q9FEG2       255 LNLIYYMVVEVLPSALVLFILRKLPPKRVSAQYHP 289 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap