Conserved Protein Domain Family
YjbH

?
pfam06082: YjbH 
Exopolysaccharide biosynthesis protein YbjH
YjbH is a family of Gram-negative beta-barrel outer-membrane lipoproteins that act as putative porins. YbjH is one of four gene-products expressed from an operon, yjbEFGH, which is regulated by the Rcs phosphorelay in a RcsA-dependent manner, similar to that of other exopolysaccharide biosynthetic pathways. It is highly possible that the yjbEFGH operon encodes a system involved in EPS secretion since none of the products is predicted to have enzymic activity, the products are all secreted and YbjH and F are predicted to be beta-barrel lipoproteins similar to porins. It may be that the operon products play some role in biofilm formation and/or matrix production.
Statistics
?
PSSM-Id: 399225
Aligned: 47 rows
Threshold Bit Score: 610.771
Threshold Setting Gi: 81656767
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8ECI3                  40 SQSDFGGVGLMQMPTGRMAPEGEFNFATTYNDDYQHFSASVQLFPWFETTIRYTQVQDLLYSd----DPSFS------GN 109  Shew...
Q7NZZ5                  31 SLN--GQIGYINMPSARVGDDGTMSFGYSYDKPYGTLWTSTTILPWLEVSGRYISIAg---------APGFTdqqyggGY 99   Chro...
Q2LWK9                  33 gpaNWGGTGLLETPTARVMPEGKFRVGFSQVDPYRRYYGAVSPLKGLELDGKVTEFLGVTANpn--sSPDWE------GY 104  Synt...
WP_013944646            37 hynstfmGGYFNMPSARMNDVGMVALGFAYVPPYRNYGVTFQPLRRVEFGVNYRVYIgip-----dpAMGFM------GF 105  Simk...
WP_013181142            58 yfnHLLYGGYWNMPSSRMGEEGEMGVGWSKVPPYENFNVRLQPFRHVELSGNYRIFRgid-----dsALSKH------GF 126  Wadd...
CCB87648                52 ffNHLLQGGYLNMPSARMGQEGEIGAGFSYVPPYHTYNLRFQVLDRLEISGNYRVFRgir-----dpILSPY------GF 120  Para...
WP_020949319            38 rVNNYGLPGGIDTPSAEVLPDGTLGATLSYSNLFRRNTLVFQATPRLTVALRYSRId---------sTEDPR------GF 102  Para...
Q3IYL3                  34 SLNLYGATGLIDMPSGEAQPDGIFNTSITSFAGITRTTLTFQITPRLSASFRYQGIGDWNKSipeadRVGVN------KF 107  Rhod...
goetting:PGA1_65p00160  24 SLNFYGSPGLVDMPSAEMLPDGQFTSTYSWFGGQARYNLTFQATPWLSASFRYNGIqt--------nGAQIA------GF 89   Phae...
jgi:Dshi_3858           71 SLNFYGVPGLIDLPSGEAMPDGQLAVGVSTFGGTTRTTLSFQLTPRISGSFRYSAIRDWDS----------D------GF 134  Dino...
Q8ECI3                 110 SKYTDKGIDFKVRLLE-ES--NWLPETSIGVRDFGGTGLFDGEFIAATKRV------------GPLDFTLGIGWGYIGNS 174  Shew...
Q7NZZ5                 100 GRYKDKAIDTKFRLVE-ET--RWLPEISLGFTDIQGTRLWKGTNLIATKQVl-----------PGLETTLGYGSGRI--- 162  Chro...
Q2LWK9                 105 GNDKDKSFDLKHQFLA-EG--KYRPAVALGIMDPHGTRKFPSQYLVMSKQI------------YPFDFTLGFGNGRYG-- 167  Synt...
WP_013944646           106 GEFSDRGANLKLGVLRkEDgfPYFPEIAVGFEDFYGTKRFHSFYVVATKTFl----------dWNFEATLGWGKGRI--- 172  Simk...
WP_013181142           127 GDFSDKGANIKVAFWFpEDsdYAVPGLAVGWEDFIGTKAFEARYVVLTQVFp----------kWNLEASLGYGDMRI--- 193  Wadd...
CCB87648               121 GDLSDKGANVKFAILKpEDsdYSLPGLAFGLEDFMGTSAFKARYFVFTQVFl----------pQNLEISLGWGWHRI--- 187  Para...
WP_020949319           103 --IWDRSFDLRYQVLD-ENpdGWMPAVAIGMQDFIGTGIYSAEYLVATKSLt----------pR-LRVSAGLGWGRLATT 168  Para...
Q3IYL3                 108 DTYYDRSFDLRFRAFD-EG--RYMPAVTIGLQDFVGTGIQSAEYVAATKHLt----------pR-LKVTAGVGWGRLGSY 173  Rhod...
goetting:PGA1_65p00160  90 STYYDRGFDVRLRLLR-EG--RYRPAVTVGLQDFAGTGIYAGEYIVATKNFdtpalshrggtgR-LKLTAGLGWGRLGSN 165  Phae...
jgi:Dshi_3858          135 DTYYDRSFDLRFLALE-ES--RFLPSVTIGLQDFAGTGIYAGEYIAATKTFa----------gG-LKGTVGLGWGRFGSA 200  Dino...
Q8ECI3                 175 GNLTSDK-KDLNYNCDR--DtsfGGSGGTVDYQRWFKGCAALFGGVEYQtPW--------EPLRLKVEYDGNDYQSDYPV 243  Shew...
Q7NZZ5                 163 ---------------------------------------QGMFGGLRYT-PSf------lPNWSLVAEYDANNYSQDPHP 196  Chro...
Q2LWK9                 168 ---KNPLpAQGEGFRVEilS----------DPRSWLED-SQFFGGIEFA-PS--------ERFSFILEYSPIRYEKQTGD 224  Synt...
WP_013944646           173 ---------------------------------------KGFFGGIGWT-PFrqtkipvlNKLTLLAEYDAVDYEHHQWE 212  Simk...
WP_013181142           194 ---------------------------------------DGWFGGISWV-PFrksynrylENLAFVAEYDAIPYKSKKRE 233  Wadd...
CCB87648               188 ---------------------------------------RGLFGGVHWI-PFrqhcspllKNFALVAEYDAIPYHDHRIE 227  Para...
WP_020949319           169 GGWGSPf-GNRPPPDAG-------T-GGKPNIDEWFRGPMAPFANVSWQ-AT--------DKLTLTAEYSNDNYACETDI 230  Para...
Q3IYL3                 174 GSFGGV--GTRPEFVPQ------ESEGGEVNADQWFRGDMAGFAGIEWQ-PT--------DRLTLKAEYSSDDYEEEAED 236  Rhod...
goetting:PGA1_65p00160 166 GSIGSIa-GTRPGFVGG------ST-GGELSYDQWFRGEMAPFAGIEWL-PN--------DRWGFKAEYSSDAYVLETGA 228  Phae...
jgi:Dshi_3858          201 SSFGGLIsDERPAFDPN------DT-GGEPSTDQWFRGPQSVFAGIEWQ-PT--------DRLGLKLEYSTDAYEAETVD 264  Dino...
Q8ECI3                 244 ir--geSTMPQ-----------DSKFNYGLLYRFGDWGDLHLSYERGNTWTLGFSLQTNFNTLS--QIKTDpaatkyKP- 307  Shew...
Q7NZZ5                 197 fvaqtfATEYR-----------KKGPAIGLEYQWG-WLGLQVARQKTHN-SVNAHIDIPLNVTEfvPKIQEpayftgGPd 263  Chro...
Q2LWK9                 225 saqakyFQEPV-----------PSKWNIGLRWKPVDWAEIDVSWQRGEQLGVNLSTSFDLG----------------KPl 277  Synt...
WP_013944646           213 hps-grSV--------------KSRINVGLSATLFDCLQLNVSSLRGEDIAASASLNYNLGESKglFPKVD------NPp 271  Simk...
WP_013181142           234 phpdgrSV--------------SSPINYGVKYRLWDRIDCSASYVRGEEWAFSFSSFFPLGTCSgvLPKID------DPl 293  Wadd...
CCB87648               228 khphgrDK--------------KSSFNFGIKYRLWDIFDFSVGQVRGSKLAFSASANYNFGTTKgfFPKIN------NPi 287  Para...
WP_020949319           231 ------PDECRrspwlsdkeklKNKINLGFTYQLGDSYQLGGYVLGAKQVGLQFSVAMNPRQTAypSGLEK------AG- 297  Para...
Q3IYL3                 237 ------RQIFDr----------KSPFNFGAEYEVSRGVQLGAYYMYGSEIGLGLHFVLNPRDRAttGLVDR------AP- 293  Rhod...
goetting:PGA1_65p00160 229 ------PDVFEr----------KSSFNFGAEYQARPGLRLGAYYLYGSEIGVTAQIQLNPK-HPtqPMRVS------AP- 284  Phae...
jgi:Dshi_3858          265 ------RDVFEr----------ESDWNFGLEYQVSEDWRLGGYYLYGAELGVMAQFQLNPR-RPavPMRVA------AP- 320  Dino...
Q8ECI3                 308 ---LPAAPLTPTQTEsstpvniptvaqvtvsadtsethksevqnaevanlepvnasnqavtntQVDWNKVTHDLQT---I 381  Shew...
Q7NZZ5                 264 lptRPTLDQ------------------------------------------------------WKGDSSRARQLASalgN 289  Chro...
Q2LWK9                 278 ---VPIYDHPWREKP------------------------------------------------EFRSDPLAERLIRalyA 306  Synt...
WP_013944646           272 iykAPVDTEPVGL--------------------------------------------------LRSNKELAQELAFafdE 301  Simk...
WP_013181142           294 pycAPKNLEPIGP--------------------------------------------------LRPCDVLAQEIYTtfeC 323  Wadd...
CCB87648               288 pyqAPQNIEPLGD--------------------------------------------------RRPEMAMIQDLIYpfdE 317  Para...
WP_020949319           298 ---APVRPRVAPSADpegwsgaw---------------------------------aadptaqpAIQKALGDALAK---E 338  Para...
Q3IYL3                 294 ---TPIRPRPARAADpeawssew---------------------------------vtqedapaLLRNNMQKQLDK---D 334  Rhod...
goetting:PGA1_65p00160 285 ---VPVAPRSSWATEdshwsrdw---------------------------------aqstraktTLRDLMSEALQQ---D 325  Phae...
jgi:Dshi_3858          321 ---DPVDPRPDRAANptlwsadw---------------------------------itipgaqeTLRDALEAPLAA---E 361  Dino...
Q8ECI3                 382 AGYANAKIY--LAHD-----SITVVGEQTTFRDRNEAHQRAATILANNTDaTHIKEYRLIETRYNQPITET--------- 445  Shew...
Q7NZZ5                 290 QDFKNIRIA--MQRD-----TLVMELGNSRISNVGRAVGRAVRTALYYAP-LETREIKVVYTELEQPVATYnfydmttln 361  Chro...
Q2LWK9                 307 SGFRDIGIE--ASGD-----ELRVEAANDRYFYTPAAVEVALRVLAQIVP-PEFTTLRLTLTDRGIPLVAL--------- 369  Synt...
WP_013944646           302 QGLNLYRIY--LTTDehgdhALWIKMINVRYRVEKELKERIETVLAALVP-TNVKAVTVVIEADGVPTHEY--------- 369  Simk...
WP_013181142           324 QGINVLRVW--LSTDafgqhILRLEVENCVWRYEEWFRERLSQLLANIAP-RNIDLVVVELQTDGLPVQEY--------- 391  Wadd...
CCB87648               318 QGFDLIKMS--ISPDcygqtTLRIHVENRVYRTQCEVRTRLNHLLSHLSP-TNIDHIIVVIEAEGLPLQEY--------- 385  Para...
WP_020949319           339 -GQELQGMV--LTAK-----RAEVRINNGRYIQQAEAVGRTARLMTRALP-PSVEEFVITSTERGMPISSV--------- 400  Para...
Q3IYL3                 335 -GVLIEAFG--TDGR-----TAQIRIRNIRYDAEAQAIGRTARAMAYSLP-ASVETFEIVPVVRGVPLSKV--------- 396  Rhod...
goetting:PGA1_65p00160 326 -GLILEALTlpADGT-----EAELRYRNPRYRAQTLAIGRAARAMARLLP-PSVETLKIVPMRGGLALSQV--------- 389  Phae...
jgi:Dshi_3858          362 -GIELQALA--ATGT-----SIDLRYRNARYLSSANAVGRVARVLARVLP-PSIETFHLTPEVSGMPASRI--------- 423  Dino...
Q8ECI3                 446 -----LIDTQKFAQIASYSYLNAKITD----ASVVRVPSLPQG--QLVN------STDKDWldklSFDVSPTMAQSFGGS 508  Shew...
Q7NZZ5                 362 qyllgKINRERFLQTVNIKSGRDQELEplnsQTLAQSLRDGINvnLLTNrdgdwvQVTSDDtednRFHLAPKLGVYFNDP 441  Chro...
Q2LWK9                 370 -----TALREDVCLFHQEKLTANQLYAls-----------dgLktDINEtlaaekHYRRYF----DYGLKPEFQTFLNDP 429  Synt...
WP_013944646           370 -----RFRTMDLHRFRERTISDFEFATls-pMREPTRPPSRYDgsLIYH------RSKSVW----TFTVRPRLLTFFGSA 433  Simk...
WP_013181142           392 -----HYRMEFLQMFADDKMCPYELSVv--sPKREVSCFDDCCkqLIYK------EERPRF----CWSIFPETYTAFGSA 454  Wadd...
CCB87648               386 -----HFAVRFLHDFAAKEIATPELNVl--sPLCDVSFSSPACsrVIFE------KPRDLF----NIELFPKMHTFFGSS 448  Para...
WP_020949319           401 -----VVRRSDVERLENT--EAGQIANaatlVSA-EPNPAGLMltPGQ--------YP-RF----RWALQPYVATSLFDP 459  Para...
Q3IYL3                 397 -----TVRRSDLERLEFAPNASGRLRPqvgvAEAGAPIAGLAFdpDRY---------P-SF----NWSFGPYLRTSLFDP 457  Rhod...
goetting:PGA1_65p00160 390 -----VIRRSDLEALEHSPDATEALWAvtglQEA-GPLAGDALvaQDL--------YP-AF----STSISPYTAPSYFDP 450  Phae...
jgi:Dshi_3858          424 -----TLRRTALEELEFTPQAGARLLAqseiSEA-PPLPETAVasETV--------AP-RF----SWSLGPYLEQSFFDP 484  Dino...
Q8ECI3                 509 EGFYMFNIGVTGSANYRFTDNFDFSGSLYLNLYDNYDKFLY---------DVPPDgt---dLK----RVRTLIRQYVHEN 572  Shew...
Q7NZZ5                 442 SGAFHYDIMAEATYKRRFSKGLYLDSALSADVYNTITAVKQp--------SNSD-------LP----HVRSDIADYKRVK 502  Chro...
Q2LWK9                 430 SGFFKYRAGVSGWLSLTPWRGGSFIAGLQGFPLNTVSSSN---------------------EPls-kPVRTDNVPYM-EK 486  Synt...
WP_013944646           434 TGKFKYSVGIVGGPEGYLFDQVYYKIQGAYNIKSSMSDVGDmd----------------mlNPsqliNVRSDMVRYYQTS 497  Simk...
WP_013181142           455 KGKFKYLLGVHLGVCGYFWNDWYYSVLLGYPITGNLCDVSDid----------------kiNPsqliNVRTDSVNYYKRE 518  Wadd...
CCB87648               449 SGKFKYLYGLNIAFDGYLLGDVYYTVLLGYAFASNLGDIKDmd----------------rlNPsqliNVRTDVIRYYQQK 512  Para...
WP_020949319           460 DDPIRYEIGAEAPFRYELQPGLVIAGSVRQRVLGSSKQESPvssltpdeyADADHdynefgVP----RVRSDSQMYSGIK 535  Para...
Q3IYL3                 458 EEPVRADLGLRLRGEYELSPGLFLSGAISHKLIGNIGDQDR---------SESN-------LP----RVRTDNYLYSREG 517  Rhod...
goetting:PGA1_65p00160 451 DLPFRLDVGVDLKASYAPAPGWRIAGTIRQRVWGNVKDG-Ra--------SNSV-------LP----HVRTDATEYAQFG 510  Phae...
jgi:Dshi_3858          485 DEPWRFEIGLDASASYQITPNLSLSGSITKEIVGTIADSTRv--------SNSQ-------LP----PVRSNGVLYAREG 545  Dino...
Q8ECI3                 573 PVRVNSLQLTWMDNLTDNISYQAYGGYLEMMYGGVGTEFLYRP-LNSQWAFGIDVNYVKQRDPDSVFGF----FEdehqy 647  Shew...
Q7NZZ5                 503 TPKLNRLLLNQYMTLSPNVYARASAGIYEEMFRGAGGQVLYYPsFNQSWAVDLAVDALQQRDVNGWFGK----RD----- 573  Chro...
Q2LWK9                 487 NVSLSMLMAEQIRKFDGEIYGRLSAGMLEVQYGGIDGEIA-RPfLGGRLMLGLSGSVVKKRDEDDPLKFkeddWK----- 560  Synt...
WP_013944646           498 SGSLEEAYIQKGEYFKKGWYGRLALGYFEVAYGGIAGEVLYYP-VGSSWAIGLEAAAVLKRKY-HGIGFttevRKfdgfq 575  Simk...
WP_013181142           519 GLSVNEAYIEKSWNLGCGHYLRAAAGLFEEAYGGVAGEWLFYP-INSHFAIGVEGAYLRKRTY-GGVGFtnkvRKlegya 596  Wadd...
CCB87648               513 GITLDQAYLQKNWNMGRGWFSRVSTGLFEEAYGGIASEVLFYP-VCSPFAIGIEGAVLKKRSY-HGVGFtnkiRKlkgfv 590  Para...
WP_020949319           536 TPVIPRLTLAWYAKPGNEVYTRVTVGLLERAYGGVSAEALWWP-TNSPFAVGAEINSVKKRDFDGLLKF----RD----- 605  Para...
Q3IYL3                 518 DTTIDSLTAAWYAHPARNIYSRVTVGYLERMYGGASAEVLWKP-VESRLALGAEINYAKKREFDQGFGFlsgdEA----- 591  Rhod...
goetting:PGA1_65p00160 511 -TTLKNLYVTRQWQMGRDLYARSTAGLFESMFGGISGEVLWKP-VSSRLALGVEGNYVVQRDYDQRLSF----RD----- 579  Phae...
jgi:Dshi_3858          546 DPGLDNLVLAYTFRPGQDLYGRVSAGYLESMFGGVSAELLWKP-VDSRLALGVELNYARQRDFDQRLGF----QD----- 615  Dino...
Q8ECI3                 648 dpitnsnyrvqTGTVTGNATFYYQpdWFPN-TLLRVSAGQYLTEDKGVTVDFSKQFDSGVIVGAFATKT---N-LSAEEY 722  Shew...
Q7NZZ5                 574 -----------YQTVTAITSLHYQ--LPMG-VTTTVRAGRFLAKDDGVRFELSRRFRSGVEAGFWYTKTnghD-ITSPGT 638  Chro...
Q2LWK9                 561 -----------DTYTTAFVNARLN--IPRLeSAIDIKYGRFLAGDRGTRITLSRFF-NGLELSAWYSWT---DtDGFSDS 623  Synt...
WP_013944646           576 ------sekvhFIGYQYFLDLYYE--FKPLqLDFKVSIGKFLARDVGARFEIGRYFPSGLRFSVWYTWTnahDiVNNERY 647  Simk...
WP_013181142           597 p-----tyvepFYPKQYFISAYYN--FEELdLDLELKGGKFLADDWGVKTEISRYYPSGLRLFAWYTYTdgkDyVNGQLY 669  Wadd...
CCB87648               591 ------ptykrFLGKQYFANLHYD--CKPLnMDFHVKWGKFLANDWGTRFEVTRYFDSGLQVSFWYTRTsakDyINGSRY 662  Para...
WP_020949319           606 -----------YNVTMGSVSAYYQ--FQNG-IDAELSVGKYLAGDKGATLTLSRQFANGWRLGAWVTKT---D-MSSEAF 667  Para...
Q3IYL3                 592 -----------YDVVTGHASVYYD--FGNQ-FLGQIDVGRYLAGDYGATVSLDREFENGWKVGAFATLT---D-VSSEEF 653  Rhod...
goetting:PGA1_65p00160 580 -----------YKTFTGHASAYYQ--LDKG-YHVQLDAGRYLAGDYGATFSLDREFANGWRVGGFFTLT---D-VSSEDF 641  Phae...
jgi:Dshi_3858          616 -----------YDVITGHASAYYA--FGDG-YLGQVDVGQYLAGDKGATFTLSREFGNGWKLGGFFTLT---D-VSAEEF 677  Dino...
Q8ECI3                 723 GEGSF-TKGFYISIPFDLMTVKSTHSRATISWMPLTRDGGQMVGRKYYLFDNTDA 776  Shewanella oneidensis
Q7NZZ5                 639 PEKPYnDKGIFITIPLNSLLTFDSRTVGGFSLSPWTRDVGQMVMTPGDLYDILSN 693  Chromobacterium violaceum
Q2LWK9                 624 HNRGYhDKGIAVTIPLRLFKGSDSRTVYKYSLSPWTRDVAQDIDHHTSLFDFIgr 678  Syntrophus aciditrophicus SB
WP_013944646           648 R-----DKGVAFVIPFDFFLKKSSRTMIPYAMSVWLRDTGARAATGKRLYPTLHd 697  Simkania negevensis
WP_013181142           670 H-----DKGVGISIPLDIFLPCSCRNRYRWGMSAWLRDVGAIALTGNRLYWRIRD 719  Waddlia chondrophila
CCB87648               663 Q-----DRGVAVSMPLDILYTHSDRKRWGYGLSAWLRDIGVFAFTGDSLFRTIRE 712  Parachlamydia acanthamoebae UV-7
WP_020949319           668 GEGSF-DKGVNISIPLAWGTGDPSLRKVGGSIRSLSRDGGAQLYVEGRLYETIRD 721  Paracoccus aminophilus
Q3IYL3                 654 GEGSF-DKGIRLEIPLTSLLGQPTRETAKYSIRPVTRDGGARLRVEDRLYETVRp 707  Rhodobacter sphaeroides 2.4.1
goetting:PGA1_65p00160 642 GEGSF-DKGFRFSIPLDWLLGKPSRNTFGMTVRPTQRDGGQRVHVPDRLYGQIRE 695  Phaeobacter inhibens DSM 17395
jgi:Dshi_3858          678 GEGSF-DKGIMLTIPAGWILGQPNRTALSTTIRPLQRDGGQRLEVPGRLYDPVRA 731  Dinoroseobacter shibae DFL 12...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap