Conserved Protein Domain Family
UPF0231

?
pfam06062: UPF0231 
Uncharacterized protein family (UPF0231)
Family of uncharacterized Proteobacteria proteins.
Statistics
?
PSSM-Id: 399214
Aligned: 42 rows
Threshold Bit Score: 98.431
Threshold Setting Gi: 503427316
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q488R1          1 MEYEFVHDaITGEARALFSLEHEVIGPWMEVELGHNVTKLTDLLTAIDNIETGQSQELLITGSEYSITLNNEDVS-IQTN 79  Colwellia psyc...
WP_004729027    1 MEFEFTKNtLLGEYYVTCSMEHQIVARWLQEEIAQDRTKIEHVLALLEKAHQCPAQEWSYPGREISLMICGDEVT-VQDN 79  Vibrio furnissii
jgi:Fbal_3386   1 MEYEFRRE-LGGQPLVLMSMGHEALGRYLTEEC-QEAEALMRIRNALAEIRHGQRREWILNGAEQALHITEDWVR-VRDH 77  Ferrimonas bal...
Q21KK4          1 MEYEFNKD-LGGSPVATFSMGHEAIGRWLTDELASNTQRITSLLSHIEQIELGHKASLTLHGSEFELHIAGDEVS-VMAH 78  Saccharophagus...
WP_011771155    1 MEFEFRKDfFSDQATVKLSMDHEAFATWLEQE-GQSIPWVEALLVNISAVQKRVVTDFKLVGSEFSLLLNNDEAQ-VINH 78  Psychromonas i...
WP_015465779    1 MEFEFRKDfISGKVSIKTSMDHEAFATWLEME-GQSLQWVRSLLQTIEQLQNHQLSDYKLVGSEFTLQLSHKEAL-ITNH 78  Psychromonas s...
Q3IDG3         27 MEYQFIRDpISG-LRIKISSEHAIIGRWLNEEIGKD--KIAMVQALIASVSSS-FEPLTLKGQEIDLILTKDEAL-FEAH 101 Pseudoalteromo...
WP_012069398    1 MDYEIAFDqDENAYRIYTGYEFAAIGEWVSEYV-RDLESIQRVLMAARLAETE-KETTQFKHGPFDVILSEEGVHvSRQV 78  unclassified M...
CCU72799        1 MDYEFTYD-DHGHPSLSLDMGQETTANWLNSEIGTDIIKLQQLLDIIDELKAGTREKYEVKSRRFQLVLNRDEADiSEMH 79  Thalassolituus...
WP_007642788    1 MDYQFSHD-ILGHPVATCELECEAFGDWLSHEIAQDTGQVTLLLNTIQQLQTHQLSHYQHNGKEYHLVFDKDEVElILNN 79  Paraglaciecola...
Q488R1         80 vsmngSLngSGEGLPEM---LTDEHIHlDQNEMASCGLDDFRALLLSWGQFT 128 Colwellia psychrerythraea 34H
WP_004729027   80 -----AL--NYGHDIEL---ESEFELY-DSESVAQCGLEDFESLLMQWQDFL 120 Vibrio furnissii
jgi:Fbal_3386  78 -----AL--GQANGIEL---EPDLDFY-DAESEALCGLEDFELLLDSWQSFL 118 Ferrimonas balearica DSM 9799
Q21KK4         79 -----AI----DDDIEF---EKNISLY-ELESNAECGLTDFKEALQSWLQFV 117 Saccharophagus degradans 2-40
WP_011771155   79 -----SLl-NDFDEVDL---EGDLSFY-DLEIEASCGFDDFKNFIESWSEFL 120 Psychromonas ingrahamii
WP_015465779   79 -----RLl-EDEELPEF---EEALSFY-NLEIEAGCGLEDFWNLLHSWCEFI 120 Psychromonas sp. CNPT3
Q3IDG3        102 -----AL--HQDSEDLMayqDDDLMLE-ENGLSSGCGFEDFIDLINSWHEFT 145 Pseudoalteromonas haloplanktis TAC125
WP_012069398   79 -----DLdsAEEEIKAMfdsQESFYQTsTDGIQAECGLEDLINMIENWHEVl 125 unclassified Marinomonas
CCU72799       80 -----NGinEQTTEDGLdyaEEGLTIY-EDESISGCGLDDLEDLLLAWQSFI 125 Thalassolituus oleivorans MIL-1
WP_007642788   80 nhiqeMAhsEEDESQEL---S-------DLHIQSGCGLADFHILLQAWQTFV 121 Paraglaciecola psychrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap