Conserved Protein Domain Family
JTB

?
pfam05439: JTB 
Jumping translocation breakpoint protein (JTB)
This family contains several jumping translocation breakpoint proteins or JTBs. Jumping translocation (JT) is an unbalanced translocation that comprises amplified chromosomal segments jumping to various telomeres. JTB, located at 1q21, has been found to fuse with the telomeric repeats of acceptor telomeres in a case of JT. hJTB (human JTB) encodes a trans-membrane protein that is highly conserved among divergent eukaryotic species. JT results in a hJTB truncation, which potentially produces an hJTB product devoid of the trans-membrane domain. hJTB is located in a gene-rich region at 1q21, called EDC (Epidermal Differentiation Complex). JTB has also been implicated in prostatic carcinomas.
Statistics
?
PSSM-Id: 398872
Aligned: 15 rows
Threshold Bit Score: 127.102
Threshold Setting Gi: 6016409
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDV27152      35 TVMKSTASNTTTNQCGEIIEVGECLPCSAFDKKSRAIRACAENGNKQLVKCrKSRQKFYKSCLMVPWIAERNYWIFQVFM 114 Trichoplax adha...
EDW50124      40 EPQFVIEDNSTCWRNEKYTMVQECHPCSEFDIVSRSLGVCIHTHYKEVLRC-QSGEIVTRSCDRVALIEQMNFLKFEVSC 118 Drosophila sech...
NP_001193393  39 vfVENVESNSTCLSGEDFKIISECHPCSAFEIASQSIGVCTKARYKEIIEC-KSGEKITRSCDRVAWLEERTFWKFESIT 117 jewel wasp
Q9N4B5        58 EKVVTEYPAEECWKHEPFEVVTQCAPCKDFEIKAIKAGHCLKTGYFDRVNCsKSSTTVLRPCPSPKQSRRHEFYLFYVVN 137 Caenorhabditis ...
XP_003088997  58 GKVATEYPIEECWKHEPFEIVTQCAPCKEFEVKAIKAAHCQKTGYFDRVNCsKSSTTVLRPCPSPKESRRHEFYLFYAFN 137 Caenorhabditis ...
O88824        37 EKLSVSTSTSPCWLAEEFVVTEECTPCSNFQIKTTP--ECGSTGYVEKITCsSSKRNEFKSC-RSALLEQHLFWKFEGVV 113 house mouse
Q1L896        48 avAVTKAMTAPCWQLEEFVVAKECSVCEGLQLKTIP--ACSQTGFIEKINCtKSNRDEYKSC-RSTKMEEHLFWKFEGTM 124 zebrafish
XP_015221518  32 NEMSSSAQPLHCWETEEFTVLRTCFLCRDYQMKTEA--QCTFSGFVEELKCnTSGLIEHRSC-RSAAAEELKFWKFEGAM 108 spotted gar
XP_014348027  34 DTTYTSLQLRPCWEMEEFLVLKECTQCSDYEKKART--ECSSTGFVENVKCkNSDQVELRSC-RSVTAEELKFWKFEALM 110 coelacanth
OWR55520      43 NKTFPTENNSTCWLHQPYTIINECHPCSDFEIRSKSIGVCIHTSFKEILKC-ANGETVTRSCDRVAYLEERAYWKFTIWS 121 Danaus plexippu...
EDV27152     115 LIVALPSWATVWIRRRKLEEQARRRVQRQI 144 Trichoplax adhaerens
EDW50124     119 FVIGLLSYLVSYARDRVLSRRNYMRIERQL 148 Drosophila sechellia
NP_001193393 118 FVGAILSCIAVFWRENILRQRVIRKVARQL 147 jewel wasp
Q9N4B5       138 AAILIVSFLSTTQRKAQLERAVYMRLPQHF 167 Caenorhabditis elegans
XP_003088997 138 IILLIISYSVTVQRKSVLERSVYMRLPQHF 167 Caenorhabditis remanei
O88824       114 VAVALVFACLVIVRQRQLDRKALEKVRKQI 143 house mouse
Q1L896       125 LALTVVFAIIVVIRQRSLDRQASDKVRRQI 154 zebrafish
XP_015221518 109 LTFSTLFAVLVMFRQRTLDRRAEYKVQQQI 138 spotted gar
XP_014348027 111 FSIGTVFAILVVLRQQTLDQKAEQKVLRQI 140 coelacanth
OWR55520     122 LVLGMASSIAVMLRMRVLNHKAKRRARQil 151 Danaus plexippus plexippus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap