Conserved Protein Domain Family
SseC

?
pfam04888: SseC 
Secretion system effector C (SseC) like family
SseC is a secreted protein that forms a complex together with SecB and SecD on the surface of Salmonella. All these proteins are secreted by the type III secretion system. Many mucosal pathogens use type III secretion systems for the injection of effector proteins into target cells. SecB, SseC and SecD are inserted into the target cell membrane. where they form a small pore or translocon. In addition to SseC, this family includes the bacterial secreted proteins PopB, PepB, YopB and EspD which are thought to be directly involved in pore formation, and type III secretion system translocon.
Statistics
?
PSSM-Id: 398516
Aligned: 20 rows
Threshold Bit Score: 71.378
Threshold Setting Gi: 14195444
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7NUX0   101 IMASTLMTSQMLGDTAAVKSKALDIMSTKQEALRKKEVENIREQMNKAieqQDKAKKAGILSVVFDWVVAAVEVVTGVAK 180 Chromobacterium vio...
Q6MBE0   332 KATLREIQVHDAEKSKENAKAKFGELADRRLR-AQEQAEKMEKMLKKQ----KQMKSMGLAMKIIGPIIAALSTIIGTLI 406 Candidatus Protochl...
Q7VWI4    81 adllrvLRSRAVDGQLATARENLQDAQVKAKQNTQAQLDKLDAWFRKA----EDAESKGWLSKVFGWIGKVLAVVASALA 156 Bordetella pertussis
CDM23295  77 vdlLRSLRSKSDDAQLATAQKSLESARIKAEKNTEHQLEKIKEWIEKS----KEAESKGALGKIFGWIGKIFAFVAAIAA 152 Castellaniella defr...
Q2SH38    69 LLALQSLQVKLDEEGVKSGKEDAKFLAQENKERHKEVMEALQKSINEM----EKAKKSGMFAKVFGWIAAAATLIAGAAM 144 Hahella chejuensis ...
Q87P61   115 EVELAAITDKLKSAQNELKIQEVKVAKAKHEQEMAENQEKIKESEAAA----KEAQKSGLAAKIFGWISAVVSIVVGAIM 190 Vibrio parahaemolyt...
Q9I324   111 EIELAKITGEVENQQKKLKLTEIEQARKQNLQKMEDNQQKIRESEEAA----KEAQKSGLAAKIFGWISAIASIIVGAIM 186 Pseudomonas aeruginosa
Q7N0X3   113 EINLGELTSKLDRIQTSLKIQDIQRARQQSLQKMEENQQKIKEAENSA----KEAQKSGLFSKIFGWISAITSIVIGAIM 188 Photorhabdus laumon...
O84583   142 MGLIMTLLAQASAKSWSSSFQQQNQAIQNQVAMAPEIGNAIRTQANHQaqaTELQAQQSLISGITNIVGFAVSVGGGILS 221 Chlamydia trachomat...
O84947    94 SMMMTSLILNVFGNNAQSLCQQLERATEVQNALRNKQVKEYQEQIQKAieqEDKARKAGIFGAIFDWITGIFETVIGALK 173 Salmonella enterica...
Q7NUX0   181 MIGGVMTgnvMQAAGGAMDLV--AGMAGLVKAMANTMALIDPENaekyQKV--------------ADIA--GKIQLSFEI 242 Chromobacterium vio...
Q6MBE0   407 AIASLGTataASVA--IIAAGvaVGIAMTAYSIADSVTGVTQKIitafKDA--------------LDKLmpDSPDWVKSL 470 Candidatus Protochl...
Q7VWI4   157 VGFAAVAsvvTGAAATPMLV---LSGMALVSAVTSLADQISREAggppislggflsg-lagrlltalgvdqSQADQIAKI 232 Bordetella pertussis
CDM23295 153 VVAAAAAtvaTGGAAAPLLA---LAIVGAISATMTLASAISQECggpeisinsliqhtvgkfltdvcgvdpKQAENICKI 229 Castellaniella defr...
Q2SH38   145 IATGAGA-----IAGGVMM----ALAVDQMVGMATGKSAVSELTnaiaK----------------------GLANVMGEP 193 Hahella chejuensis ...
Q87P61   191 VATGVGA-----AAGALMIAGgvMGAVSMALQEPAVQDALKEAG---------------------------VNVDVLNKV 238 Vibrio parahaemolyt...
Q9I324   187 VATGVGA-----AAGALMIAGgvMGVVSQSVQQAAADGLISKEV-----------------------------MEKLGPA 232 Pseudomonas aeruginosa
Q7N0X3   189 VATGVGA-----VAGALLIVGgvMGVVSQGLQQAAQDGLISKET-----------------------------MKWLGPV 234 Photorhabdus laumon...
O84583   222 ASKSLGGlksAAFTNETASAT--TSATSSLAKTATS-------------------------------------------- 255 Chlamydia trachomat...
O84947   174 VVEGFLSgnpAEMASGVAYMA--AGCAGMVKAGAETAMMCGADHdt-cQAI--------------IDVT--SKIQFGCEA 234 Salmonella enterica...
Q7NUX0   243 AGAVV-DVTSAARNL--LVTKMIPKVAGKVLKEGaEQMVSTAIKKGTAGAAKNAANAVGKQVADQVATQ---------VA 310 Chromobacterium vio...
Q6MBE0   471 VKALIvAAVVAVLAV--IIVLAMASGSG-------AGAATNAASQAVQQTIRIAVTEAIKQMALQAMIMaimssnalpEL 541 Candidatus Protochl...
Q7VWI4   233 VAG---LAVPAVLLIepQMLGEMAEGVAR------LAGAGDATAGYIAMAMSIVAAIAVAAINAAGTAGagsasairgAW 303 Bordetella pertussis
CDM23295 230 VGGALaIACPVMLAIepSLLGNMAQSIAL------MAGADEKTAGYIGMALTIAAAIGIGIAMAVMTGGasaastaaqVS 303 Castellaniella defr...
Q2SH38   194 ANAIV--ASVIVAAV--LIIGTAGAGMYASATT--SAGKAASVASNSSKTASSAAS-AGKTAGAATQAGatassssqaAT 266 Hahella chejuensis ...
Q87P61   239 VMALE-IAVAVIGAI--VTFGGAAAGGIAKL----AAKSASKIAQKVTDIATKAAANMAKVADM---------------- 295 Vibrio parahaemolyt...
Q9I324   233 LMGIE-MAVALLAAV--VSFGGSAVGGLARL----GAKIGGKAAEMTASLASKVADLGGKF------------------- 286 Pseudomonas aeruginosa
Q7N0X3   235 ITAIE-ITMAVAAAA--VSFGGSAAGLIAKM----GAKMGSKVAEMTAKMAVKAAEFSAKA------------------- 288 Photorhabdus laumon...
O84583   256 ------ALDDVAGTA--TAVGAKATSGAASAASSaATKLTQNMAESASKTLSQTASKSAGGLFGQALNTpswsekvsrGM 327 Chlamydia trachomat...
O84947   235 VALAL-DVFQIGRAF--MATRGLSGAAAKVLDSGfGEEVVERMVGAGEAEIEELAEKFGEEVSESFSKQfepleremaMA 311 Salmonella enterica...
Q7NUX0   311 QALGKAAVdaakattkktvekfaqkftnqmlerftheaiekmvsksvekvikkavkegveltaqevtkrvvnqvfadvvK 390 Chromobacterium vio...
Q6MBE0   542 VGGILKASgvdkktqq-------------------------------------------------------ivemvvmaI 566 Candidatus Protochl...
Q7VWI4   304 DRAAAVATq----------------------------------------------------------------------- 312 Bordetella pertussis
CDM23295 304 NKVLLSSIktfntvl----------------------------------------------------------------- 318 Castellaniella defr...
Q2SH38   267 NSLSKLAQslsewpllh--------------------------------------------------------------- 283 Hahella chejuensis ...
Q87P61   296 GSKAATTTakair------------------------------------------------------------------- 308 Vibrio parahaemolyt...
Q9I324   287 GSLAGQSLshslk------------------------------------------------------------------- 299 Pseudomonas aeruginosa
Q7N0X3   289 AGTAANTTsrglr------------------------------------------------------------------- 301 Photorhabdus laumon...
O84583   328 NVVKTQGTraakfagralss------------------------------------------------------------ 347 Chlamydia trachomat...
O84947   312 NEMAEEAAefsrnvennmtrsagksftkegvkamakeaak--------ealekcvqeggkfllkkfrnkvlfnmfkkilY 383 Salmonella enterica...
Q7NUX0   391 ATIKATLKapalvvsstvrgvAAGAKEIMVGEIEKQRAKLQKEIDLLILDQQWLQS--FFEFYEQEKKEVIKKTRELLDS 468 Chromobacterium vio...
Q6MBE0   567 TLIACVIA-------------MAKVGGAKSGGTEQKAADAAEEATKEAAKTVTQRAsdALKDFKSQLDNVKESIKKLPET 633 Candidatus Protochl...
Q7VWI4   313 --------------------vLQGGTAVAQGGVGVSMAVDRKQADLLVADKADLAA--SLTKLRAAMEREADDIKKILAQ 370 Bordetella pertussis
CDM23295 319 ---------------astnvaVSGSTQIAQGGLNISKAQSEEKAQKAMADKKDLEA--MMLKLQKQMEEGREEMKKIIQQ 381 Castellaniella defr...
Q2SH38   284 -------------qarnmslfVSSGAQVGGGAAGVDASVHTKEANDAKAEEALVRK--VIMQNQAGIEQAIEHIKSLTSN 348 Hahella chejuensis ...
Q87P61   309 ----------------ygaetVDLTVNIGKGATDSVHAANNANVTEIQADITDLRA--KMTLSQAVIDKLKEEIGKLMED 370 Vibrio parahaemolyt...
Q9I324   300 ----------------lgvqvSDLTLDVANGAAQATHSGFQAKAANRQADVQESRA--DLTTLQGVIERLKEELSRMLEA 361 Pseudomonas aeruginosa
Q7N0X3   302 ----------------vamqvGDSGVDVTNGAAQTTNAAFQSKAANRQADVQLSRS--ELTAFQAVMDRLKEELSHLVES 363 Photorhabdus laumon...
O84583   348 ----------amnisqmvhglTAGIDGIVGGVIGAQVAQEQRMAGMAEARAEE------LKSLNSVQAQYASQAQQLQEQ 411 Chlamydia trachomat...
O84947   384 ALLRDC-------------------------------------------------------------------------- 389 Salmonella enterica...
Q7NUX0   469 KSQVIDDGLQAMSQ--AAS 485 Chromobacterium violaceum
Q6MBE0   634 MQQEFKSMMQGFKNldKWD 652 Candidatus Protochlamydia amoebophila UWE25
Q7VWI4   371 FDAAYHMIAQMISD--MAS 387 Bordetella pertussis
CDM23295 382 IEESTQLVSKMIAG--TTD 398 Castellaniella defragrans 65Phen
Q2SH38   349 SESTLSQMVNYINQ--EQQ 365 Hahella chejuensis KCTC 2396
Q87P61   371 FQELMSIIMQMIQA--KSE 387 Vibrio parahaemolyticus
Q9I324   362 FQEIMERIFAMLQA--KGE 378 Pseudomonas aeruginosa
Q7N0X3   364 FQNVMEMIFQMLNA--RGD 380 Photorhabdus laumondii subsp. laumondii
O84583   412 SQQSFNSALQTLQS--ISD 428 Chlamydia trachomatis D/UW-3/CX
O84947   390 ----------------SFK 392 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap