Conserved Protein Domain Family
DMT_YdcZ

?
pfam04657: DMT_YdcZ 
Putative inner membrane exporter, YdcZ
DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.
Statistics
?
PSSM-Id: 398369
Aligned: 111 rows
Threshold Bit Score: 61.3818
Threshold Setting Gi: 123174621
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65J96           10 LFMMLGLFAGMASPIQTSINSELRNAIhsPFIASLISFLVGMLVLLFLTSFIEhRrLflnnlqTAKTFVTSSPWWLWTGG 89  Bacillus lic...
WP_012369071      2 RGILFAISGGFFLTLQSVANARISNGIg-TWQAATLTQMTGFVVALLITLILR-D-R-------TFRQMKDVKVLYLSGG 71  Exiguobacter...
WP_012369310      2 KGIVFALFSGLFIALQGIFNARLGDAVg-PWISVTIVHFVGLIGCLLIYGFVR-D-R-------KIGGFRTLPLIYASGG 71  Exiguobacter...
jgi:Clos_2853     2 LGIIFSILAGIFVSLQSVFNTRVSDKVg-LFETTVIVHATGLIVAIAAMVLWS-D-G-------SLKRIGEVNKLYLLGG 71  Alkaliphilus...
Q97DD1            2 IGIISSIISGICMSLQGVFNTRLSEKIg-LWETNAWVQGTALLVTLVICFIYG-N-G-------NLKMIGTANKLYLTGG 71  Clostridium ...
Q899N2           13 LGIIFSIIAGISMSFQGVFNTRLSDKVg-LWEANFLVQSIGAILTLIALLLLG-D-G-------NIKKIKEVNKLYLSGG 82  Clostridium ...
Q8XH76            2 lGIILAIISGAAMSIQGVFNTRVSEKIg-VWETNTIVQGSAFVLALLIMLMLR-N-G-------NYSELRSVNKIYLLGG 71  Clostridium ...
tigr:NT01CX0945   7 LGFIYSVVAGIFMSIQGVFNTRLGEKIg-LWETNTLVQGIGFIITLIIMLFAG-E-G-------NIKNITTANKLYLLGA 76  Clostridium ...
jgi:Cphy_1952     2 IGWIVALISGALMSIQGVFNTGVTKQTs-VWVASSFVQFSALIVCLAAYFITG-R-Eg-----NFGQLIRIQDKYMLLGG 73  Lachnoclostr...
Q6M0K5            5 wALIFAIVVGFVASLQPIINSKLGEHIg-SKNAVFVNFIIGLVLIGLIILISD-P-Ss----iKQLSKVPAINPVYLLGG 77  Methanococcu...
Q65J96           90 ILGVVFITSNILLLPIVGASLTVVLALSGQMIIALVIDHFGWFGIPKHRLNVQRILGIVLMITGIMI 156 Bacillus licheniformis DS...
WP_012369071     72 ALAAAVLFSNMTAVHLMGVTLTISLFLIAQLGLALVIDWNGWFGMIKRRLQLPQVIGILMMIGGVLI 138 Exiguobacterium sibiricum
WP_012369310     72 LLGVLVVVTELTSIQLLGMTWAMSLLLVAQILCAFVIDLNGWFGVIKKSSNTGQWVGVGLMLTGVLI 138 Exiguobacterium sibiricum
jgi:Clos_2853    72 AFGVIIIYSVMRGISLLGATFSVSILLVTQLIVATVIDIYGLFDSPQIKFDFTKPLGILIMIAGIVV 138 Alkaliphilus oremlandii O...
Q97DD1           72 ILGAIIIFTVMKGVSSLGPTCSISIILIAQLLSAAIIDFFGLFHTDRLTFDSTKIIGVVLMLAGIIC 138 Clostridium acetobutylicum
Q899N2           83 LLGVIIIFTVMKGIKSLGPTYAISTILVAQLLSAALIDAFALFGSEQIRFGMSKVLGIVVMIVGIVI 149 Clostridium tetani
Q8XH76           72 AIGVVITYTVMAAVGSLGPTFGISIILISQLLTAGIIDAFALFDSEKIRFAAHNYLGIILMIVGIII 138 Clostridium perfringens
tigr:NT01CX0945  77 PLGVGITFTVMQGIGKLGPAYATSAILIAQLLFSGIIEGLGLFGSEKIHFGITKILGFIILIIGILV 143 Clostridium novyi NT
jgi:Cphy_1952    74 AIGAFITFTVIQSIGSLGPAKATILIVTAQLVASYVIELFGIFGTEKVPFEWRKLIGLALMIGGIIT 140 Lachnoclostridium phytofe...
Q6M0K5           78 IMGVVIVLLSLIVVPELGALSAFSIFVGVQLISGALIDHFGIFGIQKSPITLLKLFGISLLLLGMRi 144 Methanococcus maripaludis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap