4S3E,3NOY


Conserved Protein Domain Family
GcpE

?
pfam04551: GcpE 
Click on image for an interactive view with Cn3D
GcpE protein
In a variety of organisms, including plants and several eubacteria, isoprenoids are synthesized by the mevalonate-independent 2-C-methyl-D-erythritol 4-phosphate (MEP) pathway. Although different enzymes of this pathway have been described, the terminal biosynthetic steps of the MEP pathway have not been fully elucidated. GcpE gene of Escherichia coli is involved in this pathway.
Statistics
?
PSSM-Id: 398309
Aligned: 384 rows
Threshold Bit Score: 340.849
Threshold Setting Gi: 524285131
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4S3E_A            9 PTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLlaegaEVPLVGDF 88  Thermus ther...
jgi:Fluta_1533   28 REVKVGITTIGGKNPIRIQSMTTTDSMDTAGSIDQSIRMIDAGCELVRLTAPSKKEAENLRVIKKELvkrgyNTPLVADI 107 Fluviicola t...
WP_013452189     24 IPVKVGDVTIGGDNPIVLQSMTTVDTMDTEGSIEQSIRMIDAGCQLVRITAPSIKEAENLRAIKEGLkkrgyNSPLVADI 103 Marivirga tr...
WP_015809258     13 REVAIGDVPMGGLNPIRIQSMTTTDTMDTIGTVEQTIRMVNSGCEYVRITAPSMKEAENLANIKKELrlrgyNVPLVADI 92  Pedobacter h...
UCNUF:IALB_0322  24 REVYIGDIPLGGNNPIRIQSMTTTDTMNTEATVAQTIRMVEAGCEYVRITAPSINEARNLENIKNELrkrgyKVPLIADI 103 Ignavibacter...
Q11T09           26 SVVTIGKVPMGGDYPIRLQSMTTVDTMDTMGSVEQIIRMVEAGCEYVRVTAPSVKEAQNLENIKNELlkrgyDVPLVADI 105 Cytophaga hu...
WP_012780078     25 ITIHIGDLPMGSDYPIRVQSMTTVDTMDTQGSIDEVIRMVESGCEYVRITAPSVKEAQNLENIRNGLrklgiQVPLIADI 104 Dyadobacter ...
jgi:Runsl_0385   32 ITVKIGDIPLGSEYPIRVQSMTTVDTMNTEGSIEQVIRMVESGCEYVRITAPSVKEAQNLENIRKGLrargySVPLIADI 111 Runella slit...
CDA94532          4 ltaTAGNVHIGSDYPIAVQTMCNTHTYDEDATVAQCKRMYEAGADIVRITVPGLPDVQHAKAIHDKLraegiDTPIVADI 83  Bacteroides ...
WP_022545751      4 vEVKVGNVTMGGNQRPIVQTMCNTATQDIESSFRQCVMLYDKGAEIIRLTTQGIKEVEALRVIKSRLrdneiYVPLVADV 83  Bacteroidale...
4S3E_A           89 HFNGhLLLRKYPKMaeaLDXFRINPGTLGRgr-----------------hkDEHFAEMIRIAMDLGKPVRIGANWGSLDP 151 Thermus ther...
jgi:Fluta_1533  108 HFTP-NAAEIAAKH---IEKVRVNPGNYADkkkfeeidyteesyqaeliriEKKFTPLVLLCKEHQTAMRIGTNHGSLSD 183 Fluviicola t...
WP_013452189    104 HFTP-NAAELAAKI---VEKVRVNPGNYADkkkfenieytdesyqaeldriKKRFKPLVKICKEHGTAMRIGTNHGSLSD 179 Marivirga tr...
WP_015809258     93 HFTP-NAAEAAARI---VEKVRVNPGNYADkkrfenieythqayqaeldriYKKFTPLVKICKEYGTAMRIGTNHGSLSD 168 Pedobacter h...
UCNUF:IALB_0322 104 HFTP-NAAELAARI---VEKVRINPGNYVDkkkfelieytdaeyeaeleriREKFVPLVRICKEYGTAMRIGTNHGSLSD 179 Ignavibacter...
Q11T09          106 HFTP-NAAELAAKI---VEKVRINPGNYADkkkfevieytdasyqeeleriREKFIPLVKICKEYGTAMRIGTNHGSLSD 181 Cytophaga hu...
WP_012780078    105 HFTP-NAAELAARI---VEKVRINPGNYADrkrfevidytdasyaaeleriREKFIPLVKICKEYGTAMRIGTNHGSLSD 180 Dyadobacter ...
jgi:Runsl_0385  112 HFTP-NAAELAARI---VEKVRINPGNYADkkrfelidytedeyqreleriREKFIPLLKICKEYGTAMRIGTNHGSLSD 187 Runella slit...
CDA94532         84 HFSS-ETAIAVAPF---VEKVRINPGNFSKdfd----------------eaSRQLARLVAVCKEHGTAIRIGLNHGSLGE 143 Bacteroides ...
WP_022545751     84 HFSA-DVAIAAARV---ADKVRINPGNFakef----------------diaANKFSELIEVCKEEGTALRIGINHGSLGE 143 Bacteroidale...
4S3E_A          152 ALLTElMDRnaRrpePksahevvlEALVESAVRAYEAALEMGLGeDkLVLSAKVSKARDLVWVYRELARRTQ------AP 225 Thermus ther...
jgi:Fluta_1533  184 RILSR-FGD--T---P--------EGMVQSAMEFIHICRKNDYH-E-LVISMKASNTLVMVQAYRLLVKTMKeqg-mnYP 246 Fluviicola t...
WP_013452189    180 RIMSR-YGD--T---P--------FGMVESALEFIRICEEMEFY-D-IVVSMKSSNPQVMVQAYRLLVQKLDeeglkpYP 243 Marivirga tr...
WP_015809258    169 RIMSH-YGD--T---P--------RGMVESAMEFIRMCEDLNYY-N-LVISMKASNTQVMVQAYRLLVETMVkeg-mnYP 231 Pedobacter h...
UCNUF:IALB_0322 180 RIMSR-YGD--T---P--------LGMVESALEFLRICEDEGYH-N-IVLSMKASNPQVMVQAYRLLVNKMEaeg-mnYP 242 Ignavibacter...
Q11T09          182 RILSR-YGD--T---P--------LGMVESALEFLRICEDLEYY-N-IVISMKASNTQVMVQAYRLLVQKLEeeglrpYP 245 Cytophaga hu...
WP_012780078    181 RILSR-YGD--T---P--------LGMVESALEFLRICEEFNYY-N-IALSMKSSNTQVMVEAYRLLVQRLDeeglkpYP 244 Dyadobacter ...
jgi:Runsl_0385  188 RIMSR-YGD--S---P--------LGMVESALEFLRICEEFNYY-D-VVLSMKSSNPLVMVEAYRLLVNRLDaeglkpYP 251 Runella slit...
CDA94532        144 RITNL-YGN--T---P--------EAMAEAAMEWLRLCVKNDFY-N-VVVSLKSSNTYVMVEAYRLLAKKMQeeg-vvFP 206 Bacteroides ...
WP_022545751    144 RIVEK-YGD--T---P--------LGMVNAALEWIEMSKENNFD-Q-IVLSLKSSNTRIMVDAYRLLYKEMItrg-eaYP 206 Bacteroidale...
4S3E_A          226 LHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPgeprTKEVEVAQ-------------------------- 279 Thermus ther...
jgi:Fluta_1533  247 LHLGVTEAGDGEDGRIKSAVGIGALLEDGLGDTIRVSLTEDP----EFEIPVAQklaqkfqekneyklnysskinfdyfn 322 Fluviicola t...
WP_013452189    244 LHLGVTEAGEAEDGRIKSSVGIGTLLEDGLGDTIRVSLTEEP----EEEIPVAKvladryneredhdeiplidnclfnpy 319 Marivirga tr...
WP_015809258    232 LHLGVTEAGDGEDGRIKSAVGIGTLLEDGLGDTIRVSLTEDP----EFEAPVAKalamryekraldlygkmlfsetktiv 307 Pedobacter h...
UCNUF:IALB_0322 243 LHLGVTEAGGGEDGRIKSALGIGTLLEDGLGDTIRVSLTEDP----EFEAPVAIslanryegrenhepikpidespidpf 318 Ignavibacter...
Q11T09          246 LHLGVTEAGEAEDGRIKSAVGIGTLLEDGLGDTVRVSLTEAP----EFEIPVAQklvdryidrkkhaaipfveknpinpy 321 Cytophaga hu...
WP_012780078    245 LHLGVTEAGEAEDGRIKSAVGIGTLLEDGLGDTVRVSLTEAP----EKEAPVARalieryatrashapiepvdhcpinpf 320 Dyadobacter ...
jgi:Runsl_0385  252 LHLGVTEAGEGEDGRIKSAVGIGTLLEDGLGDTVRVSLTEDP----EFEAPVAAalinrythraerttpirpleaspihp 327 Runella slit...
CDA94532        207 LHVGVTEAGNGDSGRIKSCVGISALLSEGLGNTIRVSLTEDP----VNEIPVGRylalryegklnstmtsvkiegrraea 282 Bacteroides ...
WP_022545751    207 LHLGVTEAGNGEAGRVKSAVGISALLSEGIGDTIRVSLTEDP----ANEIPVARfiadyffmrqndyfgnsviskledgt 282 Bacteroidale...
4S3E_A              --------------------------------------------------------------------------------     Thermus ther...
jgi:Fluta_1533  323 hnkritnsllniggsntsivfsdlskknkivstnffgfgysysepldkwnifdqaadlvylgdqtidfeipgtlrivqny 402 Fluviicola t...
WP_013452189    320 eyekrdsrqvaniggqevpivmadfslkqnitpasffgvgynysvpldkwsisdfacdyiftndkavdfeipgtlgivhs 399 Marivirga tr...
WP_015809258    308 pgqlpyspfeyqrrvtvpvqhigghfhpavmldvshenlkdpyflaavgyqysagldkynmadqacdivylgdqlpsfsf 387 Pedobacter h...
UCNUF:IALB_0322 319 nynrrktfevlgiggtnvprvfadysnrkiisqkdledigytydepsdkwylsdtaadliylgknilpfdcpnglkaiyd 398 Ignavibacter...
Q11T09          322 sykrrtttdvhtigglnvprviadfsdveslevqdlksighfylpaldkwsmndlgadfiytgknkapfmlpnglkeivd 401 Cytophaga hu...
WP_012780078    321 qytrrdtrevynlghlnvprviadysnievqqlddlksighfflpvpdkwamndqgadfiysgqkpvpfmlpnglreild 400 Dyadobacter ...
jgi:Runsl_0385  328 fqysrrktkevlnfgggnvprviadfsnievtryedlrsvghfylpvpdkwkmndigvdylytgarpssfmlpmglkeiv 407 Runella slit...
CDA94532        283 vydspsrerllldfsc---------------------------------------------------------------- 298 Bacteroides ...
WP_022545751    283 tlckttfnclnwdqf----------------------------------------------------------------- 297 Bacteroidale...
4S3E_A              --------------------------------------------------------------------------------     Thermus ther...
jgi:Fluta_1533  403 eawkthkrsday----------------------------plctlqeytknkpegvvfllvdldaetavselpseqiiyv 454 Fluviicola t...
WP_013452189    400 hktwldekhkerrfpfi-------------------npkdylkgvevhpklnfiyailsdlseelivklkndptavllid 460 Marivirga tr...
WP_015809258    388 pgnlkqvynystwlslkdkn------------nchpllsydeylsvelhdeqlnlvkitaenalqtdlsalkdkvvlvle 455 Pedobacter h...
UCNUF:IALB_0322 399 feiwqklenkynsypvfdfgnytrtvnksdelnfvkiksdliddeklksikndntavlilethnlhgmadqrrvffelik 478 Ignavibacter...
Q11T09          402 adtwkvltdqthvfplfmarw----------yktdvvkhpqlnfvvadiedvddalllrlasdttavlilesfnehamae 471 Cytophaga hu...
WP_012780078    401 ypqwlvhpekhikfplfnvad-----------wnaatevsselnfiegdihtfneaflnevagktnivlvlhtdnahamp 469 Dyadobacter ...
jgi:Runsl_0385  408 dyevwktlrerehsfplftl------------aefeaaeekshalnfiiidaatqitkeqladtpavlvlqtdnahampa 475 Runella slit...
CDA94532            --------------------------------------------------------------------------------     Bacteroides ...
WP_022545751        --------------------------------------------------------------------------------     Bacteroidale...
4S3E_A          280 ------------------------------------------------------------------------------EI 281 Thermus ther...
jgi:Fluta_1533  455 aetkkhqktqvirkfqyelaelnnrvpvilklnyeleelemlqlyassdagihfidgfsdgiwitaprplvdlnslsfGI 534 Fluviicola t...
WP_013452189    461 tynthgmaeqrrlfmelmqkscdvpvvigrayqdlsleklqlysatdmggllidgfgdgvfiaaencggdkainetafNI 540 Marivirga tr...
WP_015809258    456 tsslngvaaqraffnaliekglqipviikrsytavntddlmlyaatdmgalltdgmgdgvwidadallglslinatsfGI 535 Pedobacter h...
UCNUF:IALB_0322 479 qdihnpviikrdynktsfenlqlysstdlgallidgfgdgvwlnvneltsieaesglyvksfirkseskekvinrllfNI 558 Ignavibacter...
Q11T09          472 lrrsfitlmnreiatpviikraythkneetlflaastdaggllvdglgdgiflssekmilaekeallaylksvnnlgfGI 551 Cytophaga hu...
WP_012780078    470 emrrffykltemknrlpviirrsyqtdlgdrltlysatdiggllvdgfgdgtllcpdfsgaehaeklkaaaayngiafGI 549 Dyadobacter ...
jgi:Runsl_0385  476 lrrcmidliaqgidcpvvirrtystentdelslfaatdcggllvdglgdglmlsahhdaegtyaerlkhaaqqnsigfGI 555 Runella slit...
CDA94532        299 -------------------------------------dfgkrlldkeidevhisgvyhdengaavsisesglgkyledEL 341 Bacteroides ...
WP_022545751    298 --------------------------------------iltascelgpplldkiiddvaielycpehfitddlnrfrdTL 339 Bacteroidale...
4S3E_A          282 LQALGLRAFAPEVTSCPGCGRTTStFFQELAEEVSRRLkERLpewrarypgvEELKVAVMGCVVNGPGESKHAHIGISlP 361 Thermus ther...
jgi:Fluta_1533  535 LQATRTRISKTEYISCPSCGRTLF-DLQETTGKIRERT-SHL----------KGLKIGIMGCIVNGPGEMADADYGYV-G 601 Fluviicola t...
WP_013452189    541 LQASRTRISKTEYISCPSCGRTLF-DLQETTAMIRNRT-NHL----------KGVKIGIMGCIVNGPGEMADADYGYV-G 607 Marivirga tr...
WP_015809258    536 LQATRTRISKTEYISCPSCGRTLF-DLQETTQLIRSRT-DHL----------KGIKIGIMGCIVNGPGEMADADYGYV-G 602 Pedobacter h...
UCNUF:IALB_0322 559 LQAARQRISKTEYIACPSCGRTLF-DLQETTEMIRKRT-EHL----------KGVKIAIMGCIVNGPGEMADADYGYV-G 625 Ignavibacter...
Q11T09          552 LQAARTRMTKTEYISCPSCGRTLF-DLQETTAMIRKRT-DHL----------KGVKIGIMGCIVNGPGEMADADYGYV-G 618 Cytophaga hu...
WP_012780078    550 LQAARTRMSKTEYISCPSCGRTLF-DLQETTAMIRKHT-EHL----------KGVKIGIMGCIVNGPGEMADADYGYV-G 616 Dyadobacter ...
jgi:Runsl_0385  556 LQAARTRMSKTEYISCPSCGRTLF-DLQETTALIRKRT-DHL----------KGVKIGIMGCIVNGPGEMADADYGYV-G 622 Runella slit...
CDA94532        342 LQASRRRFYKPEYIACPGCGRTMY-NLQAAFEQVKQRT-AHL----------KDVVIAVMGCIVNGPGEMADADWGYV-G 408 Bacteroides ...
WP_022545751    340 LQASRRKFSSPEYIACPGCGRTLF-NLETVFNEVKKRT-SHL----------AGYNIAVMGCIVNGPGEMSDADYGYV-G 406 Bacteroidale...
4S3E_A          362 GA-GEEpkaPVYADGKlltIL-KG---EGIAEEFLRLVED 396 Thermus thermophilus HB8
jgi:Fluta_1533  602 TGpGKI---NLYKEKT---VVkKNvseEEAVDALIQLIRD 635 Fluviicola taffensis DSM 16823
WP_013452189    608 SGkGKI---TLYKGQE---VMkRGvpsERAVDELIDIIRQ 641 Marivirga tractuosa
WP_015809258    603 TGpDKI---TLYRGKE---VVkKNvnaARALDDLIDLIKE 636 Pedobacter heparinus
UCNUF:IALB_0322 626 SGvDKI---TLYREKN---IVrRNiptKNAVDELINLIKE 659 Ignavibacterium album JCM 16511
Q11T09          619 VGkDKI---ALYRGQT---VVnKAvhsDKAVDELINIIKE 652 Cytophaga hutchinsonii ATCC 33406
WP_012780078    617 MGkDKI---ALYRGQD---VIkRSvhsSKAVEELIELIRE 650 Dyadobacter fermentans
jgi:Runsl_0385  623 IGkDKI---ALYRGQQ---VVkKSvvaNNAVDELINLIKE 656 Runella slithyformis DSM 19594
CDA94532        409 EGnGKV---SIYHKKE---PVlRHvpeNEAVDKLVSLIEN 442 Bacteroides sp. CAG:709
WP_022545751    407 EGkNKV---TIYRGKE---PVyRSvpeDRAIDMLLELIEE 440 Bacteroidales bacterium CF
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap