Conserved Protein Domain Family
DUF505

?
pfam04458: DUF505 
Protein of unknown function (DUF505)
Family of uncharacterized prokaryotic proteins.
Statistics
?
PSSM-Id: 398255
Aligned: 20 rows
Threshold Bit Score: 514.203
Threshold Setting Gi: 295434199
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Nitsa_0669         1 MLIKKEHAVALYNVLGEENKGTH-CQISV-AA--EREp--YNELNLANLLEMgS--SKVEFRLSYWGRNLVYLLDEMIQN 72  Nitrati...
BAT71239               1 MVVTGEGVRILKSIAEGKEITKEtEE--------------ARVLELAGILRY-D--LPGKYSLTYTGESLVDLIRSIEEK 63  Thermos...
PRJNA61347:EYM_06845   1 MLLKREYLEMLEEVGDKELDINEfVKGE--YEerERLiknLLALELQDLIRPkDarNPRIFVLTEHGKKVLDIWKRL--- 75  Ignicoc...
jgi:Igni_0126          1 MLLKREYMQVLEKFKGKDEVDVAeVATGE-YEeaENVlfiLLALEVQGLIEPvSkeRPRSFRLTEAGKKVLEAWEEA--- 76  Ignicoc...
Q8TZ95                 1 MLLLKDHAEVLLTVEELGTREEArEIAEEaEAvtEIIpqrLLELELQGLMKRvG---PNEWELTDAGKTAAKAVAEA-VD 76  Methano...
Q58750                 1 MFLKKRHLEILKKMKETEMQNEIeKALPE-EFktR-----ALELFILGFAEL----KGDKIIFTEAGKKLMEIVDKI-DL 69  Methano...
jgi:Metin_0703         1 MFLKKRHLEILKKMKETESQKEIeKALPE-DFknR-----VVELYILGFVEL----EGDSIRFTEAGKRLLELVEKL-DI 69  Methano...
Q5JFF3                 1 MYLKKRHIEILREMKNTESQAEIeAKLPE-DFqiR-----AIELYILGFAEL----EGGKIKLTDAGRKLLEITDKLSLE 70  Thermoc...
WP_112426668           1 MLLTGAHVAALRELASSEEAGQAaYELAE-DDr-RALt--YRALELQGLAAL-E--LPRSYRLTYAGREALQLLEEMRRD 73  Thermog...
WP_126554493           1 MLLTTAHLIALRTLSDSEIAGHTaYVPEEsDDqnHI----YRELELQGLAVLvP---PRAYQITFTGHEALGIFDGMQKS 73  Dictyob...
jgi:Nitsa_0669        73 GKLDIP--------------ANWKEGYRWIGSETIAMIEAAMKNGGFVGPVAEEALTERGFAEKVRdehc-gectKLNDY 137 Nitrati...
BAT71239              64 GVDT----------------SKWEDNFRFVGSEVIAMIDSVIRAKGRVFEDFVKPLEERGFVKDGE----------LTPE 117 Thermos...
PRJNA61347:EYM_06845  76 GKPQVE---------------------RWLDSRIHMMLWTLWKTKSEAPKDWKTPLLERNFVNEEG---------KLRDE 125 Ignicoc...
jgi:Igni_0126         77 GRPEAE---------------------RWFDSSIHAAVWSLWRTSAKAPKDWFTPLRERGLVDEEG---------FLTDA 126 Ignicoc...
Q8TZ95                77 ILEQPP--------------QEWAHD-RWVGSDTVLALKHAALSFV--PERWEELLSERGLSEDGE----------LTKA 129 Methano...
Q58750                70 EKIPDI----------------------FVDSEIIKIMELLEETGNVP-EDWMLMLKERFLADENG----------LTEI 116 Methano...
jgi:Metin_0703        70 ENLPEI----------------------FIDSEIIKIMELLEETGQVP-EDWLALLKERQLADDNG----------LNEI 116 Methano...
Q5JFF3                71 ELPDVI-----------------------ADTEIIKMMELLEETGKIP-ESWMEKLRERKLADENG----------LTPF 116 Thermoc...
WP_112426668          74 WQAGSLrldergqlllagehENGEQNWRFLGSDILAALQAAEHAGGRVGPATAGLLQARGLTEEATdplhksvvqRLNRH 153 Thermog...
WP_126554493          74 SSIPPI--------------DQLKKDWRLLGSDIQAALHAAAQNKMHVGPLTEDVLNTRGMTEKKHdtlekrtftNLNTF 139 Dictyob...
jgi:Nitsa_0669       138 AEALYDIYL--HSHPKLEITQNLANFIVSMPEGPA-EKNGLDY------EGREAELLESMRLLSYSVP--NTDIFSLNRL 206 Nitrati...
BAT71239             118 GEELWEIYR--LAKPHLTIDQELAKLVKKLPVGPVrKTGVIDM------DDRQVKFLEAQRLIAFSMP--PADFFTFTGL 187 Thermos...
PRJNA61347:EYM_06845 126 AIELLKVFEpgIRARKIRITRDLGGVLARIAPGPAtTAALKNH------PEDALDLLEAMDVIVYSAP--DGGYYALTRL 197 Ignicoc...
jgi:Igni_0126        127 AKKLVEQFEpkVRPVKVRVTRDLGWTLARVPPGPAaVAPLSKF------PEEHIDLLEAMGVIVFTSP--DRKYYALTRF 198 Ignicoc...
Q8TZ95               130 GELVLEAYF--KATPKLYVTQDVAGRIARLPPGPGtLKTFIRYretidiPDNIFHALEAMRLLVISPPadGGRTYTLTAL 207 Methano...
Q58750               117 GKEILKIYR--ETHPVVYLTPELLAFIKDMPKIGV-YDELITYkntkeyGDNIINALQAMRLLLISPKteSGKAFSTTKA 193 Methano...
jgi:Metin_0703       117 GKEILKIYR--ETHPIVYLTPQILSFVRNMPKIGL-YDELITYknsknfGDYIINALQAMRLLMISPKt-SDKAFSTTKT 192 Methano...
Q5JFF3               117 GKALLEVYR--ETHPVVYLTPEIASFLRGMPKIGT-LDELVTYknsklyGDNIVNALQAMRLLLISPPteKGRAFATTPA 193 Thermoc...
WP_112426668         154 GRAWLDFAR--RHRPRLEIDGELANAIQRMIPGYS-GRPAPGL------SGDFIDLLEAMELITWSLP--DGRFYALTAL 222 Thermog...
WP_126554493         140 GEAWEDFDQ--RHHPLLEINQDLANGMRHMHPSYT-ARPDLTL------SAEHLSLLEAMDLLTWSSP--DRTTYALTTL 208 Dictyob...
jgi:Nitsa_0669       207 GKAVKNAITHMAYPYD--AVISEDYLHVLAYYLDNGfeALNDKEKELMESLALIDAEGKLLPGGEALEEVLHILREQAYL 284 Nitrati...
BAT71239             188 GQKVKEALEKGAQPFP--IAVSVDIMLAVKRAKESPe-HLSENDIVALQAMAYIDENLELLPAGEALYMAYKLYNEGALL 264 Thermos...
PRJNA61347:EYM_06845 198 GRYLRMAIRELRPVAMeyILVNMKIIELVKKLIEGK--ELTDQEKFVLMNLGYM-TVSEPTKAAKLLYKAIEELERGKYW 274 Ignicoc...
jgi:Igni_0126        199 GRFLREAIRELRPVAMeyVLVNMKIAEMVKKLVEGG--ELTEEEKYWLMNLGYY-RDGKPTRAAKWLYLALKELERGEWW 275 Ignicoc...
Q8TZ95               208 GREVKYAIEKAIPAMH--LVLSPGIMEDVKAVSEGE----EPEDMERLERLGYA-WKGSLTRAGEHVLRAYEMVGED-FP 279 Methano...
Q58750               194 LNYVLKVASLVPNLSRa-LILRKEDFEILER----------GETTEEMTESGFY-AEGKVTELGQAMMDTYKEMGKVEEK 261 Methano...
jgi:Metin_0703       193 LANVIKIANMVPNISRa-LILRKEDFELLE----------SGKGSESLEESGFY-KEG-VTELGKEMMETYKGLGKVEEK 259 Methano...
Q5JFF3               194 AKLALKALNMIPVFARa-IVLRKEDFEMLK----------AGKRNAELESMGLADEKGT-TEFGKAIMDTYEAMGRVEEK 261 Thermoc...
WP_112426668         223 GEAVYEALRKGGYTLGa-VVLDEPTLKLLALLVDRGseALTADQRERLQELGFMGLDSYLTPAGEAALRAYALLQSERPV 301 Thermog...
WP_126554493         209 GQAAYEAVLKEGYPVLd-EVLNKAIMTVLAQFIDQGrdALTPEQLFNLQMLGYVDGEEKITAAGQAAMRAYSLLQQEVEE 287 Dictyob...
jgi:Nitsa_0669       285 PARTFDLEALDVEILRGIDEVMKRHESNPEVLPAPEEIRHYLLDLPLKEYKAVKEHYGRRLNEDMgyQKKEELKKKFAEA 364 Nitrati...
BAT71239             265 LTPSIVLSDDDVEVLFAADELWKKYQQNPEIMPTPTQIREYIA------------------------KVRPAIEKE---- 316 Thermos...
PRJNA61347:EYM_06845 275 ETFTIGLTRVDQWVMKMIDYLWKKAETNPELKPTKSLIVDWF----------------ERHWKDIgmDEETRKELLFSDY 338 Ignicoc...
jgi:Igni_0126        276 DTFPIGLTRVDEWVLKTIDHLWKKAENNPELKPTKKLIQYWI----------------EKHRDELgmDEETYKELEFSDY 339 Ignicoc...
Q8TZ95               280 GVPPISIRPSELRLLEIIDHLYRP-DENPNVAPTLKRIKRVLVEE----------------------------------- 323 Methano...
Q58750               262 TLPIYVLED-EIKVLKAIEEIKEKYETNPEIIPTYDEIKKRT-------------------------------------- 302 Methano...
jgi:Metin_0703       260 TLPIYVLED-ELEVLKAIEEIKKIYETNPKVIPTYKEIEKRV-------------------------------------- 300 Methano...
Q5JFF3               262 VLPMYLLED-ELSVLKAIQEIEKKYETNPDILPTEKEIERRV-------------------------------------- 302 Thermoc...
WP_112426668         302 SVRTFALTEAEVEVLLTLHQLAARQ-ENGGPSPDLERLRKTLVEQLAERYREIVGRYGRRLEERS--ALKRRAVELLGEL 378 Thermog...
WP_126554493         288 PSRTFAITEPELELLATLHSISDPSSTRPQPPPDKQALHKIFVDRMVQHYQQFIGRYGRDFKGKL--AKKQRAVAMLEQL 365 Dictyob...
jgi:Nitsa_0669       365 LTVEelfksfyekgnHWLEKLMDvIEESLMTLKSFSLVEAKlsE---D-GKLYYDMTPEGRLVFEEQKEkGFREISAPAV 440 Nitrati...
BAT71239             317 ------------------------VMKILYSLECFGILTSEe-G---PkGRLVYTFTDWGKKVLADQKE-ARRPISSPAV 367 Thermos...
PRJNA61347:EYM_06845 339 T-----------------------VGISLYRLEALELVDSYeeK---Sk--LIYQLTDYGKQLLEVIEKgKIVEIPTYAI 390 Ignicoc...
jgi:Igni_0126        340 T-----------------------IGLALYRLEAVRLVDSY--E---EkGKLVYELTEYGKRLLEVLG--QITEVPAHAV 389 Ignicoc...
Q8TZ95               324 -----------------YGEADPdPTTDLKELEAHGFVEKTvcDygkEkGKPIWVLTEEGERLLHGLGA----PVRAEGV 382 Methano...
Q58750               303 --------------------NIDdLGAVLHTLESKELIKREvvK---Nk--DTYWMTEFGEKVK------DLGEVSTDGM 351 Methano...
jgi:Metin_0703       301 --------------------NIKdLGETLHILESKELIERKvvD---Nk--DTYWMTEFGEKAK------EFGKVTTDGM 349 Methano...
Q5JFF3               303 --------------------DVKdLGAILHLLESKELIERRlvK---Ek--DTYWLTEWGKEAI------NFGTVSPDAM 351 Thermoc...
WP_112426668         379 RSRD-----------EWFDSLWD-LEELIASLEALALVRTEsdG---E--RTLYRLTPYGQRVVEEQQQeQIRAISSTAV 441 Thermog...
WP_126554493         366 KDHD-----------KWFNTFWD-LDELLVSLAAFDLVRPErmD---Qk--TVYIITPNGQRIVEAVGR-GTNDISATGV 427 Dictyob...
jgi:Nitsa_0669       441 KAITIRESEFGAPNLEWYEAAKAEHLVGG-GAPTHSGEIYADLAYNVERKPHITRFELQILHK-LP-ERGYFVESLYEDF 517 Nitrati...
BAT71239             368 KCITITRKEFSAPGVDWYEEAVEQKLVGS-YGPTKSGTMYADLAVSIDRLPHITDYEMEVLSR-ISdENPLYLKEYMKGD 445 Thermos...
PRJNA61347:EYM_06845 391 RPLVYADR-GLPPFRSWIEEAAKEGLLGP-GGMGRKGRKLAHLARVVKRRPLLTRMELLVLQKmLPsGQVQKIEELVKKF 468 Ignicoc...
jgi:Igni_0126        390 KTLVYADK-GIPPFRLWIEEAIRWGLMGP-QGAGTKARVLMWISRRVKRLPLITKLEHLVLQKtLPsRRAEPLEELVKRV 467 Ignicoc...
Q8TZ95               383 KAVTVSMG-FESPSPEWLEEAHRAGLVSQ-AAITTKGLMAAKIARRVERAPFLTGDEAKLIYR-MP-NGSIDRGKLIEDV 458 Methano...
Q58750               352 KAITYPES-GDVPIAEWVIKGKEEGTVK--RGITEKGKYLIKLSKTIKRKPYLTKYDISTLIK-IPrKRYIHRDELVKLI 427 Methano...
jgi:Metin_0703       350 KAITYPEA-GDVPIAEWVMVGKEEGTVK--RGITEKGKFYMNLSKTIKRKPYLTKYDVSALVK-VPkKKYIHRDELVKLI 425 Methano...
Q5JFF3               352 KAVTYAES-GDVPIAEWVLKAQEENVVK--AGVTDKGRFYLRLSREIKRKPFITRYDAAILAK-TPrKKYIHRDELVALV 427 Thermoc...
WP_112426668         442 KAVSMAVTRWTGLATSWVERAREEGLVGSgGGVTRAGRLYSWLAEHCPRQPMLTRVEAEVLAN-LP-ETE--PGPFVSEY 517 Thermog...
WP_126554493         428 KVLTSAITRLHSPADLWVEQARDEGLIGTkGGITKEGHLFADLAEHCTRLPALTRDEAEMLKN-LP----QIINDIAPPA 502 Dictyob...
jgi:Nitsa_0669       518 D---PTLKEEVTYGLNKLEARGFVELLPDGGVVVTEAGHLIKRALSGTPE----SFGNALNPLVVRVLDALHE----VGN 586 Nitrati...
BAT71239             446 ----EEEQRRIRKAIEMLDAKGFVEILPTGIVVLTEAGVYMKRALAGVTS----GFGNPVTPHLVRVLEAIRE----VGT 513 Thermos...
PRJNA61347:EYM_06845 469 E-----NPDEARAALYWLEMWGAVNFYDNDYVEITEIGENLKKALVATPP----GIATPVHPHFLRVLEVIKE----LGS 535 Ignicoc...
jgi:Igni_0126        468 Sa-lGYDEEEVRAAIYWLEMWGALEVYGNGYVELTEIGDMIKHALVATPP----GVATPVHPHFIRVLQAVKE----LGS 538 Ignicoc...
Q8TZ95               459 CdryGLEEHQVLESLSKLESRGIVEELLTGGVILTRAGQHLKTAIHRGQTmeilKLRHPITPVATRLLKAVYD----LKR 534 Methano...
Q58750               428 QghvGGDEKEIIKSLGEAESKGFIKELQNKMIKLTELGEEVKTAIEMAKIqellATKFAVTPTTFNILKTIYDhkeeFDK 507 Methano...
jgi:Metin_0703       426 MehvGGEEEEIIRAINEAESKGFIVELQNKMIKLTKLGEDVKDAVEEARVpellNTKFAVTPTTFNILRAIYEnreeFDR 505 Methano...
Q5JFF3               428 QdyvGGDEKEIIRAIGEAEAKGFVVELQNGMVKLTELGDKVKTAIENAKLqeivKVKFSVTPTLYNVLKVIYDnietFNR 507 Thermoc...
WP_112426668         518 Qa--SLEGERLAWALDKLEAHGLIDRLADGQIVRTEAGRLLARAVAGATK-----LAHPITPRIVRLLEAMRQ----VGT 586 Thermog...
WP_126554493         503 EkktQQDEEKQRWALEKIEARGFIECLVDGQIVRTPIGQLLAKAISGAMH-----LGHPVTPSIVRLVAAIRQ----VGT 573 Dictyob...
jgi:Nitsa_0669       587 LYVKERKVRILPKNIKEA-IKISGLDPETFNKALTVARNAKFIGHTSINEAGLDILEAY 644 Nitratifractor salsuginis DS...
BAT71239             514 LYEKEKKIRVRPDRWKKV-EKLSGLDAETFAEVLRIARMTKFIGTNSLTQAGYYLLQSL 571 Thermosulfidibacter takaii A...
PRJNA61347:EYM_06845 536 Y-----------EDIAEI-VNRTRLTLGIVKDAIVVAREAKLLGKKDLTGEGELLLETV 582 Ignicoccus islandicus DSM 13165
jgi:Igni_0126        539 Y-----------EDLAEI-VNRTRLTLGIVKDALVVAREAKLLGAKDLTGEGELLLEAV 585 Ignicoccus hospitalis KIN4/I
Q8TZ95               535 EGVSAKKLSKFPKTL----LKRADVTLDQAKKAVGLLRRTKMMSGWKITEAGEELLRAF 589 Methanopyrus kandleri
Q58750               508 VWKEKSEGKEHKENEIVLlAKYLSLTPEEIKKNLVILKNVGFIGKKGLTDAGVKLVEAY 566 Methanocaldococcus jannaschi...
jgi:Metin_0703       506 VWKEKEEGKEHKENEIILlAKLLPLTIDEIKKSLVILKNTGFIGKRGLTDAGKKLVEAY 564 Methanocaldococcus infernus ME
Q5JFF3               508 IWKEKGEARDYKMEEVDAiRKHLSLSDDEIKKALTMLRELGFLGTKSLTEAGKVLVEAY 566 Thermococcus kodakarensis KOD1
WP_112426668         587 LYVKEQKVRLQPEQWKEV-ERLTGLGPQEFLETRHVARMGHYIGEVTLNEAGLEVLEAA 644 Thermogemmatispora tikiterensis
WP_126554493         574 LYVKERKVRIVPENWAEV-ERLTGLGPQEFKEARHVARMGQYIGDVTITEAGLDLLMVM 631 Dictyobacter kobayashii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap