Conserved Protein Domain Family
SpoVAC_SpoVAEB

?
pfam03862: SpoVAC_SpoVAEB 
SpoVAC/SpoVAEB sporulation membrane protein
Members of this family are all transcribed from the spoVA operon. Bacillus and Clostridium are two well studied endospore forming bacteria. Spore formation provides a resistance mechanism in response to extreme or unfavourable environmental conditions such as heat, radiation, and chemical agents or nutrient deprivation. The reverse process termed germination takes place where spores develop into growing cells in response to nutrient availability or stress reduction. Nutrient germinant receptors (GRs) and the SpoVA proteins are important players in the germination process. In B.subtilis the SpoVAC and SpoVAEB, belonging to this domain family, are predicted to be membrane proteins, with two to five membrane spanning. Biophysical and biochemical studies suggest that SpoVAC acts as a mechano-sensitive channel with properties that would allow the release of Ca-DPA (dipicolinic acid) and amino acids during germination of the spore. The release of Ca-DPA is a crucial event during spore germination. When expressed in E.coli SpoVAC provides protection against osmotic downshift. Furthermore, SpoVAC acts as channel that facilitates the efflux down the concentration gradient of osmolytes up to a mass of at least 600 Da. Another conserved SpoVA protein in all spore-forming bacteria is SpoVAEb, which appears to be an integral membrane protein with no known function.
Statistics
?
PSSM-Id: 397784
Aligned: 336 rows
Threshold Bit Score: 87.7967
Threshold Setting Gi: 506405990
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDC60333      24 NCLCAFVCGGLICTFGQLLRWLYgtVagmneddAGLLCSVTLVAIAVILTGLGWFDKIAKHAGAGTLVPITGFANAVVSP 103 Clostridium sp....
CDB19906       4 NYIHAFWVGGLICALVQILLDKT--Rl------MPGRVMVLLVCTGSVLSALHLYEPLVDYAGAGASVPLIGFGHLLFQG 75  Blautia sp. CAG:52
CCZ33512       2 EYINAFWVGGLICALVQILLDRT--Kl------MPGRIMVLLVCSGALLSAVGFYQPLVDYAHGGVTVPLIGFGHLLFQG 73  Firmicutes bact...
CBL23421       2 DYFNAFWTGGLICALVQILLDKT--Kl------LPGRVMVLLVCSGALLSFLGIYQPFVDFAGAGATVPLLGFGHTLWKG 73  Blautia obeum A...
WP_005950382   2 DYINAFWVGGLICALVQILLDRT--Kl------MPGRIMVILVCTGAVLSALGIFQPLLEYAGAGVSVPLLGFGNILWKG 73  Blautia hydroge...
CDE64752       6 EYFNAFWVGGLICALCQILLDRT--Km------LPGRIMVTLVCTGAVLSFLGLYDPFAEYAGAGASVPLLGFGHLLFQG 77  Blautia sp. CAG:37
CDF44230       2 DYVNAFWVGGLICALAQILLDRT--Kl------LPGRVMVLLVCLGAIISFFGWYEPFAEYAGAGANVPLLGYGNILMKG 73  Roseburia sp. C...
BAK56715       2 NYLWSFLLGGIICGISQIFMDKF--Ki------LPAYILVFMVCLGNILSLFPGYDFLIKKATGGACIPIIGFGYSLGTS 73  Candidatus Arth...
WP_007286325   4 NYLKVFLVGGTICLIAQILMDYF--Kl------QTPYVMVTYVTTGVILTFLGIYDKIVDFGAAGATVPIIGFGYSLGNG 75  Intestinibacter...
CDD09012       6 TYLKVFAVGGFVCMLGQVLINTT--Km------TSARILVTFLMLGVVLEVTGAFDYIEEFAHAGITVPITGFGSNLAKG 77  Clostridium sp....
CDC60333     104 AIDAKSEGLVLGVGTKIFTVAGPVLLYGTLAGALYGLI 141 Clostridium sp. CAG:448
CDB19906      76 VKEEMEQVGVLGVFTGGLKASAGGISAALIFGYLASLF 113 Blautia sp. CAG:52
CCZ33512      74 VKEAVDKEGILGIFTGGFTASAGGISAALIFGYLASVV 111 Firmicutes bacterium CAG:646
CBL23421      74 MQKAISEDGFLGLFTGGFTACALGVSAALIFSYLSCMI 111 Blautia obeum A2-162
WP_005950382  74 MEEAIAEEGILGLFMGGFQACATGVSAALIFSYLASLI 111 Blautia hydrogenotrophica
CDE64752      78 VKDAVKESGFLGLFQGGLKAGAVGTSAALIFAYLASWI 115 Blautia sp. CAG:37
CDF44230      74 IKEAVDKDGFIGLFKGGFTNGAVGCSAALIFGYLASLI 111 Roseburia sp. CAG:100
BAK56715      74 VIEKVKECGLFGVITGGLSGVSAGITFAIFISFIFSFI 111 Candidatus Arthromitus sp. SFB-mouse-Japan
WP_007286325  76 VIEGIKKDGFLGILTGGTIATAGGIAAAIFFGYVMAVI 113 Intestinibacter bartlettii
CDD09012      78 AIKGVKEEGILGAVKGGMSAVSSGLSAAIFFGFIFALI 115 Clostridium sp. CAG:349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap