6YVV


Conserved Protein Domain Family
SMC_N

?
pfam02463: SMC_N 
Click on image for an interactive view with Cn3D
RecF/RecN/SMC N terminal domain
This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.
Statistics
?
PSSM-Id: 426784
Aligned: 28 rows
Threshold Bit Score: 410.902
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6YVV_A          2 KVEELIIDGFKSYAtRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIA-SMsTVRASSLQDLIYk--RGQAGVTKAS 78   Saccharomyces...
P73340          3 YVKRIELSHFKSFG-GTTAIPFLPGFTVVSGPNGSGKSNILDALLFCLGLA-TSkGMRAERLPDLVNntfKGNRGSSEAS 80   Synechocystis...
O28714          2 HIEKIRLKNFKSFG-KKAEIPFFKGFTVITGPNGSGKSNIIDSILFCLGLStSTkQLRAERLTDLVHng------rSEAE 74   Archaeoglobus...
Q90988          2 YIKSIVLEGFKSYAqRTEIRDFDPLFNAITGLNGSGKSNILDSICFLLGIS-NLsQVRASSLQDLVYk--NGQAGVNKAT 78   chicken
P13456          2 SLRRIMVTAVRNL--HPVTLLPSPRINILYGANGSGKTSVLEAV-HLLG---LArSFRSTRLNPVIQy--EQAACTVFGE 73   Pseudomonas p...
WP_004246505    2 ILSRLLIRHFRNI--EQADLPLADGFNFLVGPNGSGKTSILEAI-YTLG---HGrAFRSAQANRVIQh--DENAFILHGR 73   Proteus
P0A7H0          2 SLTRLLIRDFRNI--ETADLALSPGFNFLVGANGSGKTSVLEAI-YTLG---HGrAFRSLQIGRVIRh--EQEAFVLHGR 73   Escherichia c...
P43767          2 AISRLLVEKFRNL--TAVDLDFDPCFNFLIGNNGSGKTSLLEAI-FYLG---HGrSFKSAVTNRIISy--DEPHFTLFGQ 73   Haemophilus i...
Q24098         33 HIKQIIIQGFKSYKdQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSD--EFtHLRPEQRQSLLHe--GTGARVISAY 108  fruit fly
Q00737          2 YVKQIIIQGFKSYKdQTVIEPFSPKHNVIVGRNGSGKSNFFAAIRFVLS-D-AYtHLGREERQALLHe--GSGSAVMSAY 77   Aspergillus n...
6YVV_A         79 VTIVF--------DNTDKSns---piGFTNSPQISVTRQVVLGGT---SKYLINGHRAPQ-QSVLQLFQSVQLNINNPNF 143  Saccharomyces...
P73340         81 VSVTFelhdgenlSEPGANhngngngAKISKEWTVTRRLKVTKGGnysSNYYINGETATV-TELHEQLNELRIYPEGYNI 159  Synechocystis...
O28714         75 VAILF--------SENGKK--------------YEIARKVKITEKgyySYYYLNGKSVSL-SEIHSFLSQFGIYSDAYNV 131  Archaeoglobus...
Q90988         79 VSITF--------DNSDKKns---plGFENNDEITITRQVIVGGR---NKYLINGMNASN-NRVQDLFGSVGLNVNNPHF 143  chicken
P13456         74 VQLT-----------EGGT--------------SNLGVSRERQGE---FTIRIDGQNARQ-AQLAELLPLQLINPDSFRL 124  Pseudomonas p...
WP_004246505   74 LSGL---------DEESRG--------------YSIGLSKDREGN---STVRIDGSDGHKiAELAKLLPMQLITPEGFTL 127  Proteus
P0A7H0         74 LQG------------EERE--------------TAIGLTKDKQGD---SKVRIDGTDGHKvAELAHLMPMQLITPEGFTL 124  Escherichia c...
P43767         74 IQE------------SQHQ--------------WSIGLQKLRQGN---TLVKINGEDGNKiSDLAHLLPMQLITPEGLTL 124  Haemophilus i...
Q24098        109 VEIIF--------DNSDNR-------VPIDKEEIFLRRVIGAKKD----QYFLNKKVVPR-NEVVNLLESAGFSSSNPYY 168  fruit fly
Q00737         78 VEIIF--------DNSDER-------FPTGKPELVLRRTIGLKKD----EYTLDRKNATK-NDVMNLLESAGFSRSNPYY 137  Aspergillus n...
6YVV_A        144 LIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREKAERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQST 223  Saccharomyces...
P73340        160 VLQGDVTRIITMNSKERREIIDELAGVAEFDRKIVKTKETLTEVQDREERCQIIATELERTLERLAADRQKAEKYQALRQ 239  Synechocystis...
O28714        132 VMQGDVTRIIEMSPFQRRKIIDDVAGISEFDEKKEKALEELERVRESIEKLEAVIAEVNDRLQTLERDRNEAIRYKEILS 211  Archaeoglobus...
Q90988        144 LIMQGQITKVLNMKPTEILAMIEEAAGTRMYECKKITAHKTIEKKESKLDEIRRIITEEISPTLEKLKEARASYLEYQKM 223  chicken
P13456        125 LEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALRQRNSWLRHGTLDPASQAAWDRELCLRSAEIDEYRR---------- 194  Pseudomonas p...
WP_004246505  128 LNGGPKYRRAFIDWGCFHNEPRFFAAWSDLKRVLKQRNAALRQASSYRQLLPWDKELILLTEQISQWRA----------- 196  Proteus
P0A7H0        125 LNGGPKYRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRA----------- 193  Escherichia c...
P43767        125 LNGGPSYRRAFLDWGLFHHQTSFYSAWSNLNRLLKQRNAALAQNQPYSAIKIWDVELAKLAHQVSEWRA----------- 193  Haemophilus i...
Q24098        169 IVKQGKINQMATAADSYRLKLLREVAGTRVYDERKEESLNLLRETDSKVEKISEYLKTIEDRLQTLEEEKEELKEYQKWD 248  fruit fly
Q00737        138 IVPQGRVTALTNMKDSERLNLLKEVAGTQVYEARRAESLKIMHETNSKREKIDELLDFINERLAELEEEKDELRNFQEKD 217  Aspergillus n...
6YVV_A        224 QTDLEKTERIVVSYEYYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISKLEN 303  Saccharomyces...
P73340        240 QVQEKQGWAKVIQYKAVEQQRQKLWGQLERDREQSQQIQQALDQRSQAIQTQQTELEKLNAQVKALGEEEQLAVAAQLAT 319  Synechocystis...
O28714        212 KKEEYEGYLRAHNYLTAVKSKEKVERELERLERQKDELTSKIPEINARIAELNEKINELAAKISELGDERSAEIQSRILE 291  Archaeoglobus...
Q90988        224 TREVENLRRIYVAFQYVRAEEIKDRSTNALKEAQANKKKIFESMAENEKKVKELAQQIEETEKKNNEEFGAKLHSLEAAF 303  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        249 KTRRTLEYIRYETELKDTKKALDELQLQRKSSSDKKKIYNIEIQKAQEKIKDVQKNLKEAKKKVQSTKEERSVLMTEQQQ 328  fruit fly
Q00737        218 KERRCLEYTIYSREQQEIASFLDSLEEQRQTGVEDTDINRDRFIQGEKEMAQVDAEIAECKQQIEFLKVDKAQLEDERRE 297  Aspergillus n...
6YVV_A        304 KENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKDYKMVQEQLSKQRDLYKRKEELVS 383  Saccharomyces...
P73340        320 QKAQRDQLQQRYNDGDRQITNHQQQVGQIQAEISQSQQQFLHIQQEKSFHNTQTLPQLEAAVQTSQQQLEQLRHQAQAIA 399  Synechocystis...
O28714        292 LSSELESLRRAERFYLDEAKRLEEESVKIISEISKIKEEMESLDGELEEYAIKRIQVGEIVDELAAKMELLRQRLEEVDK 371  Archaeoglobus...
Q90988        304 SELQRVDAKVRSDLDHRKQNLNSEENRLKELIKIMQEEFKAFTSKEKEIKKIKEGLNGLQEESKKDAEALASAQQHFNAV 383  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        329 LLREKTKLDLTIVDLNDEVQGDNKSKERADQELKNLKVTIAEREKELDDVKPKYEAMKRKEEDCSRELQLKEQKRKELYA 408  fruit fly
Q00737        298 ASKALAQVELQAKSLSDNQAAAQESKARHDESLKAVQSAIEERQTELKELVPRFISAKDAEDAARAKLTEAETARQRLYA 377  Aspergillus n...
6YVV_A        384 TLTTGISSTGAADGGYNAQLAKAKTELNEVSLAIKKSSMKMELLKKELLTIEPKLKEATKDNELNVKHVKQCQETCDKLR 463  Saccharomyces...
P73340        400 SASEAWVQEQTQLSRTVNQLQDELIPQRSQLAQLEERQQQLLTNLAELTPLLTKVSVELEEKQFAQGQFNFQGEALTSQI 479  Synechocystis...
O28714        372 KHRELRDRLVSRKEELEMYKERRGEILRERDKLIELLRRIDMDVEDIKNEIASIESKLKEFETEKKAKQEEVWKQEEELM 451  Archaeoglobus...
Q90988        384 SAGLSSNDSGQGTSLADQMMTCKNEISKAATEAKQAQMKLKYAQQELKTKQAEVKKMDGSYKEDQEAFEAIRKTKEKLQD 463  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        409 KQGRGSQFSSREDRDKWITNELKSISKQTRDKIAHHAKLVEDLKKDATSEKDLGQKIEEHSSELEQLRLQIDEHNKKYYE 488  fruit fly
Q00737        378 KQGRNSRFKNKSERDKWLQAEIKNNNASISSVQSVLSQTQEDINDIENDIALLEPETERLRQQIDGRGDTIQSVEQQVQA 457  Aspergillus n...
6YVV_A        464 ARLVEYGFDPSRIKDLKQREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRYATA 543  Saccharomyces...
P73340        480 QTLASDLAQLEQERSLLQETQTRLLKEQQEKQRQLDKLEAASQAQQEVQGTYATKVILQSDLPGVCGLVAQLGQVEPQYQ 559  Synechocystis...
O28714        452 SAKKMLSSADKKLFDIRAKISDVEDELKKAELELAKVKATLSTLRTYSKPVEILLDARNRRELPGIFGTVAQLGEVDEEY 531  Archaeoglobus...
Q90988        464 EMKKLKYEEAEQEAHLAKKKQLSSEISSLRELCESIEAKHPYLRFEYKNPEKNWNPNCVKGLVVTLITVKDISTSKALEA 543  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        489 LKKTKDQHQSMRNELWRKETQMTQQLQTHKEELSRADQALRSMAGKPILNGCDSVRKVLDSFVERGGQSAEIARAYYGPV 568  fruit fly
Q00737        458 AKDERDRLMDQRKYVDWPRTSCATLTIHRELWREEAKLDSILINASNEVDRAERNLSQMMDHNTSRGIAAVRRIKRQHNL 537  Aspergillus n...
6YVV_A        544 LQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAIN------------- 610  Saccharomyces...
P73340        560 LALEIAAGGRLGFLVVEDDGVAAAGIEILKQAKAGRATFLPLNKIRPPKGQNPNLSYAHGYIDLAVNlidgdr------- 632  Synechocystis...
O28714        532 VAAIEAAAGNALQFVVVETEDDAVSAINFLKAVRGGRATFIPLRRIKSFKLSLDKSILKEDGVI---------------- 595  Archaeoglobus...
Q90988        544 VAGGKLYNIVVDTEATGKKILEKGQLKHRYTIIPLSKISANSIGHEIISLAKNLIGHREVHIAISLId------------ 611  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        569 IENFSCDKTIYTAVEVTAANRLFHHIVESEYEGTQILKEMNKLKLPGEVTFMPLNRLQVKIHDYPDDpdsipmiskl--- 645  fruit fly
Q00737        538 EGVYGTLAELFEVNDRYRTAVEVTAGQSLFHYVVDTDDTATKVLEILQHEKAGRVTFMPLNRLRTKPlnmpkasdtipmi 617  Aspergillus n...
6YVV_A        611 ----------------------LIRFDESITKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGG 668  Saccharomyces...
P73340        633 -----------------ryadiFAFIFGNTIVFDTLVNARNHLGKHRIVTLEGDLLEASGAMSGGSRNQRSGLRFGTMVS 695  Synechocystis...
O28714        596 --------------------------DFAVNLVRCDKKFQPVFRFILRDTVVVDRIETAKRLMDRGFRFVTLDGDIVEKS 649  Archaeoglobus...
Q90988        612 ----------------------YNSELQKAMEYVFGTTLVCSSMDNAKKVTFDKRIMRKTVTLQGDIFDPQGTLSGGASS 669  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        646 ------------kydeqhdkalRYIFGKTLICRNLERATELAKSTGLDCVTLDGDQVSSKGSLTGGYFNTSRSRLEMQKK 713  fruit fly
Q00737        618 eklqydrayekafqhvfgktiiCPNLQVASQYARSHGVNATTPEGDRSDKRGALTGGFHDSRQSRLDAVKNLAKWRDEYE 697  Aspergillus n...
6YVV_A        669 SRNTSESLLVDIQKYNQIQKQIETIQADLNHVTEELQTQYATSQKTKTIQSDLNLSLHKLDLAKRNLDANPSSQIIARNE 748  Saccharomyces...
P73340        696 EDTAEVKQLRQRLQDIQQVQGRNEELLLERTVRSRQLTQQLMEMRQQQREAQLHGEQTERDIARLSQQQTQINQQQINQQ 775  Synechocystis...
O28714        650 GLMTGGSAEKRGILVSRELLEKERMLSDKIYELQREKEGLFAELNRAESLRKQYKDEVDRLTGMISELRNRISLLDEKIR 729  Archaeoglobus...
Q90988        670 HVTPILSKLKTMRDAEDELKIKTSQLEATEKELANLKNMAEKYQHLKQQWEMKSEEAELLQTKIQQSAYHKQQEDLLALK 749  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        714 RTEYTSQIAEFEKKLSKLRNELKSTENNINSIVSEMQKTETKQGKSKDVFEKVQGEIRLMKEELVRIEQYRAPKERSLAQ 793  fruit fly
Q00737        698 TKKSRGSEIRKELEELDQLITRAVGELQKLEQQRHQVQNSSGPLRQELRSKRDLLQKQNDNLDAKRRALRNIEGNLAALK 777  Aspergillus n...
6YVV_A        749 EILRDIGECENEIKTKQMSLKKCQEEVSTIEKDMKEYDSDKGSKLNELKKELKLLAKELEEQESESERKYDLFQNLELET 828  Saccharomyces...
P73340        776 QKLAELQQNLALLQQSLPPLEQQLASAQQQLTALETSQTHQQWQTIQIQIRTVEAEYQRQLQALRQGEDHLKDLQNSSQR 855  Synechocystis...
O28714        730 TESGRIEELREKISQKSREKENYISSLKDYNSKLAEMEEAIGELEAEIEEIERMLRGSEVPKIVEELDKIKEEHQRNREI 809  Archaeoglobus...
Q90988        750 KTIAECEETLKKTEESQRKAEEEYKALENKMKNAEAERGKEIKNAQQKLNSAKKKADDSSRKMKEKQQEVEALVLELEQL 829  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        794 CKASLESMTSTKSSLEAELKQELMSTLSSQDQREIDQLNDDIRRLNQENKEAFTQRMQFEVRKNKLDNLLINNLFRRRDE 873  fruit fly
Q00737        778 DQVDAFEAELSSPFHKALTDEEEARLESLNSNVQEYRREYQELSGKRSELETRKSVLEVELRENLNPRLDQLLAQDADIA 857  Aspergillus n...
6YVV_A        829 EQLSSELDSNKTLLHNHLKSIESLKLENSDLEGKIRGVEDDLVTVQTELNEEKKRLMDIDDELNELETLIKKKQDEKKSS 908  Saccharomyces...
P73340        856 LEEKIAQAQEKIAQHQAQDLTLAQEQEQLKIALAEMNGAIQTTEAQLAKLSEKLGSTKQERDRLETQLNQLRSQQQEQQW 935  Synechocystis...
O28714        810 LISIEKKIESLEFKREQLESSMQEKQVYLDEIKDRIDEIRRTIEEGKARVEEINSELEELRKEERELGKELKGLRKERDE 889  Archaeoglobus...
Q90988        830 KQEQASYKQQSEAAQQAIASLKEQVSALEAEAVKTRESLKNAENELSSEKGLMEERTKDIKAKSAKIEKYREQNNELQLS 909  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        874 LIQALQEISVEDRKRKLNNCKTELVSAEKRIKKVNSDLEEIEKRVMEAVQLQKELQQELETHVRKEKEAEENLNKDSKQL 953  fruit fly
Q00737        858 DEDGQGNIKETQREQKRLTKVLDKLAQRLAQVDESMEQANSRVTELTQRNAESRRELEELAKSIEKHQRRMEKSMQKKAA 937  Aspergillus n...
6YVV_A        909 ELELQKLVHDLNKYKSNTNNMEKIIEDLRQKHEFLEDFDLVRNIVKQNEGIDLDTYRERSKQLNEKFQELRKKVNPNIMN 988  Saccharomyces...
P73340        936 QWEKLQTNQQEYQENLTQLQTQLEALEQDLPDPWPEIPLLQDRDEANLDFANILEELERSIRNGQKRLEAMEPVNMLALQ 1015 Synechocystis...
O28714        890 LIKQLRNAEEEKRKIEAEIDRLEERIKLQKERLEIAESEIAEIGEVEVPENLPPLEKVEKVLDEVLVELSTFGDVNLKAI 969  Archaeoglobus...
Q90988        910 INALEHDINKYQQETADASSTLDKLLKEYKWIASEKELFGQADTTYDFEANNPKETGQKLQKLLTKKEKLEKSLNMRAMN 989  chicken
P13456            --------------------------------------------------------------------------------      Pseudomonas p...
WP_004246505      --------------------------------------------------------------------------------      Proteus
P0A7H0            --------------------------------------------------------------------------------      Escherichia c...
P43767            --------------------------------------------------------------------------------      Haemophilus i...
Q24098        954 EKWSTKENMLNEKIDECTEKIASLGAVPLVDPSYTRMSLKNIFKELEKANQHLKKYNHVNKKALDQFLSFSEQKEKLYRR 1033 fruit fly
Q00737        938 LTKQAAECAANIRDLGVLPDEAFTKYKNTDSNTVVKKLHKVNEALKKYAHVNKKAFEQYNNFTKQRETLTSRREELDASQ 1017 Aspergillus n...
6YVV_A        989 MIENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKDVTQGLE 1068 Saccharomyces...
P73340       1016 EYEKTEARLGELSEKLQTIAGERTELLLRIENFTTLRRRSFQDAFDAVNKNFQIIFAELSDGDGYLQLDDAEDPFNGGLN 1095 Synechocystis...
O28714        970 QEYEEVKARRDELVEKKMVLEKERADILDRIEKYERMKREIFFEVFTAINRNFAEIIRELANGEGELYLDSDDPFNSGLY 1049 Archaeoglobus...
Q90988        990 LLSEAEERYNDLMKKKRMVENDKIKILATIEELDRKKNKALHIAWEKVNKDFGSIFSMLLPGAKAMLVPSKKQNILDGLE 1069 chicken
P13456        195 --------------------NYIKALKPVFERTLSELVELDGLTLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQR 254  Pseudomonas p...
WP_004246505  197 --------------------EYTEDIAKDIEETCQLFLPEFTLKVSFQRGWDKETDYAQLLERQFERDKVLSYTSLGAHK 256  Proteus
P0A7H0        194 --------------------EYSAGIAADMADTCKQFLPEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHGPHK 253  Escherichia c...
P43767        194 --------------------EYAEALSPEIEQTCQLFLPELEINVSFHQGWEKNADYYEILQQNFERDRALNYTFSGPQK 253  Haemophilus i...
Q24098       1034 KEELDIGDQKIHMLIQSLEMQKVEAIQFTFRQVAQNFTKVFKKLVPMGAGFLILKTKDNEGDEMEKEVENSDAFTGIGIR 1113 fruit fly
Q00737       1018 KSIDDLISVLDHRKDEAIERTFKQVSREFATIFEKLVPAGRGRLIIQRKTDRTQRAEDDLESEDEEAKHSVENYVGVGIS 1097 Aspergillus n...
6YVV_A       1069 VKVKLGNIWKESLIELSGGQRSLIALSLIMA-----LLQFRPAPMYILDEVDAALDLSHTQNIGHLIK--TRFKGSQFIV 1141 Saccharomyces...
P73340       1096 LVAHPKGKPVRRLSSMSGGEKSLTALSFIFA-----LQRYRPSPFYGFDEVDMFLDGANVEKLSKMVR--KQAQQAQFIV 1168 Synechocystis...
O28714       1050 IKVKPNNKPVQKLESMSGGEKSLVALALIFA-----IQMYKPAPFYAFDEVDMFLDGVNVGRVAKMIK--KRSKDAQFIV 1122 Archaeoglobus...
Q90988       1070 FRVGLGDIWKENLTELSGGQRSLAALSLILA-----ILLFKPAPIYILDEVDAALDLSHTQNIGQMLH--AHFKQSQFLV 1142 chicken
P13456        255 ADLRLRLAGNNAADILSRGQQKLVGMRII-AqghlvSQARRGHCIYLVDDLPSELDDQHRRALCRLLE--ELR--CQVFI 329  Pseudomonas p...
WP_004246505  257 ADLRIRANGTPVEDMLSRGQLKLLMCALRLAqgeyfTRKNGQRCLYLLDDFASELDANRRQLLAERLK--STQ--AQVFV 332  Proteus
P0A7H0        254 ADLRIRADGAPVEDTLSRGQLKLLMCALRLAqgeflTRESGRRCLYLIDDFASELDDERRGLLASRLK--ATQ--SQVFV 329  Escherichia c...
P43767        254 ADFRFKAQGLPVEDVLSRGQLKLLMCALRLAqgehlMKEKQRHCIFLIDDFASELDQYKRALLAERLQ--QSG--SQVFV 329  Haemophilus i...
Q24098       1114 VSFTGVEAEMREMNQLSGGQKSLVALALIFS-----IQKCDPAPFYLFDEIDQALDAMHRKAVANMIH--ELSDTAQFIT 1186 fruit fly
Q00737       1098 VSFNSKHDDQQRIQQLSGGQKSLCALALVFA-----IQACDPAPFYLFDEIDANLDAQYRTAVAQMLKtiSDSTNGQFIC 1172 Aspergillus n...
6YVV_A       1142 VSLKEGMFANA---NRVFRTRF-QDGTSV 1166 Saccharomyces cerevisiae S288C
P73340       1169 VSLRRPMIEAA---ERTIGVTQaRGAHTQ 1194 Synechocystis sp. PCC 6803 substr. Kazusa
O28714       1123 VSLRKPMLEQA---DAIVGITLgRDNVSQ 1148 Archaeoglobus fulgidus
Q90988       1143 VSLKDGMFNNA---NVLYRTKF-VDGIST 1167 chicken
P13456        330 TCVDHELLREGwqtETPVALFHvEQGRIT 358  Pseudomonas putida
WP_004246505  333 SAITSGQVKDMl--DVNSRLFSvEHGKIE 359  Proteus
P0A7H0        330 SAISAEHVIDMs--DENSKMFTvEKGKIT 356  Escherichia coli K-12
P43767        330 TAITQRQLKEMq--VENKKMFSvHNGIIN 356  Haemophilus influenzae Rd KW20
Q24098       1187 TTFRPELLENA---HKFYGVRF-RNKVSH 1211 fruit fly
Q00737       1173 TTFRPEMLHVA---EKCYGVSF-RQKAST 1197 Aspergillus nidulans FGSC A4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap