Conserved Protein Domain Family
SMC_N

?
pfam02463: SMC_N 
RecF/RecN/SMC N terminal domain
This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.
Statistics
?
PSSM-Id: 308206
View PSSM: pfam02463
Aligned: 28 rows
Threshold Bit Score: 130.862
Threshold Setting Gi: 132249
Created: 22-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12267  155 FINELVLENFKSYAgKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRLSDLIHKsEAFPSLQSCSVA 233  Saccharomyces cerev...
Q90988    2 YIKSIVLEGFKSYAqRTEIRDFDPLFNAITGLNGSGKSNILDSICFLLGISNLsQVRASSLQDLVYk-NGQAGVNKATVS 80   chicken
P38989    2 KVEELIIDGFKSYAtRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMsTVRASSLQDLIYk-RGQAGVTKASVT 80   Saccharomyces cerev...
P13456    2 SLRRIMVTAVRNL--HPVTLLPSPRINILYGANGSGKTSVLEAV-HLLG--LArSFRSTRLNPVIQY-EQAACTVFGEVQ 75   Pseudomonas putida
B4F0U7    2 ILSRLLIRHFRNI--EQADLPLADGFNFLVGPNGSGKTSILEAI-YTLG--HGrAFRSAQANRVIQH-DENAFILHGRLS 75   Proteus mirabilis H...
P0A7H0    2 SLTRLLIRDFRNI--ETADLALSPGFNFLVGANGSGKTSVLEAI-YTLG--HGrAFRSLQIGRVIRH-EQEAFVLHGRLQ 75   Escherichia coli K-12
P43767    2 AISRLLVEKFRNL--TAVDLDFDPCFNFLIGNNGSGKTSLLEAI-FYLG--HGrSFKSAVTNRIISY-DEPHFTLFGQIQ 75   Haemophilus influen...
Q24098   33 HIKQIIIQGFKSYKdQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSD-EFtHLRPEQRQSLLHE-GTGARVISAYVE 110  fruit fly
Q00737    2 YVKQIIIQGFKSYKdQTVIEPFSPKHNVIVGRNGSGKSNFFAAIRFVLS-DAYtHLGREERQALLHE-GSGSAVMSAYVE 79   Aspergillus nidulan...
P47037    2 YIKRVIIKGFKTYRnETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSD-DYsNLKREERQGLIHQ-GSGGSVMSASVE 79   Saccharomyces cerev...
Q12267  234 VHFqyviDESSGT-------SRIDEEKpgLIITRKAFKNNSSKYYINEKESSY-TEVTKLLKNEGIDLDHKRFLILQGEV 305  Saccharomyces cerev...
Q90988   81 ITF----DNSDKKns---plGFENNDE--ITITRQVIVGGRNKYLINGMNASN-NRVQDLFGSVGLNVNNPHFLIMQGQI 150  chicken
P38989   81 IVF----DNTDKSns---piGFTNSPQ--ISVTRQVVLGGTSKYLINGHRAPQ-QSVLQLFQSVQLNINNPNFLIMQGKI 150  Saccharomyces cerev...
P13456   76 LT-------EGGT----------------SNLGVSRERQGEFTIRIDGQNARQ-AQLAELLPLQLINPDSFRLLEGAPKI 131  Pseudomonas putida
B4F0U7   76 GL-----DEESRG----------------YSIGLSKDREGNSTVRIDGSDGHKiAELAKLLPMQLITPEGFTLLNGGPKY 134  Proteus mirabilis H...
P0A7H0   76 G--------EERE----------------TAIGLTKDKQGDSKVRIDGTDGHKvAELAHLMPMQLITPEGFTLLNGGPKY 131  Escherichia coli K-12
P43767   76 E--------SQHQ----------------WSIGLQKLRQGNTLVKINGEDGNKiSDLAHLLPMQLITPEGLTLLNGGPSY 131  Haemophilus influen...
Q24098  111 IIF----DNSDNR-------VPIDKEE--IFLRRVIGAKKD-QYFLNKKVVPR-NEVVNLLESAGFSSSNPYYIVKQGKI 175  fruit fly
Q00737   80 IIF----DNSDER-------FPTGKPE--LVLRRTIGLKKD-EYTLDRKNATK-NDVMNLLESAGFSRSNPYYIVPQGRV 144  Aspergillus nidulan...
P47037   80 IVF----HDPDHSmilpsgvLSRGDDE--VTIRRTVGLKKD-DYQLNDRNVTK-GDIVRMLETAGFSMNNPYNIVPQGKI 151  Saccharomyces cerev...
Q12267  306 ENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKE 385  Saccharomyces cerev...
Q90988  151 TKVLNMKPTEILAMIEEAAGTRMYECKKITAHKTIEKKESKLDEIRRIITEEISPTLEKLKEARASYLEYQKMTREVENL 230  chicken
P38989  151 TKVLNMKPSEILSLIEEAAGTKMFEDRREKAERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKT 230  Saccharomyces cerev...
P13456  132 RRQFLDWGVFHVEPRFLPAWQRLQKALRQRNSWLRHGTLDPASQAAWDRELCLRSAEIDEYRR----------------- 194  Pseudomonas putida
B4F0U7  135 RRAFIDWGCFHNEPRFFAAWSDLKRVLKQRNAALRQASSYRQLLPWDKELILLTEQISQWRA------------------ 196  Proteus mirabilis H...
P0A7H0  132 RRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRA------------------ 193  Escherichia coli K-12
P43767  132 RRAFLDWGLFHHQTSFYSAWSNLNRLLKQRNAALAQNQPYSAIKIWDVELAKLAHQVSEWRA------------------ 193  Haemophilus influen...
Q24098  176 NQMATAADSYRLKLLREVAGTRVYDERKEESLNLLRETDSKVEKISEYLKTIEDRLQTLEEEKEELKEYQKWDKTRRTLE 255  fruit fly
Q00737  145 TALTNMKDSERLNLLKEVAGTQVYEARRAESLKIMHETNSKREKIDELLDFINERLAELEEEKDELRNFQEKDKERRCLE 224  Aspergillus nidulan...
P47037  152 VALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQ 231  Saccharomyces cerev...
Q12267  386 KQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRE 465  Saccharomyces cerev...
Q90988  231 RRIYVAFQYVRAEEIKDRSTNALKEAQANKKKIFESMAENEKKVKELAQQIEETEKKNNEEFGAKLHSLEAAFSELQRVD 310  chicken
P38989  231 ERIVVSYEYYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISKLENKENGLLN 310  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  256 YIRYETELKDTKKALDELQLQRKSSSDKKKIYNIEIQKAQEKIKDVQKNLKEAKKKVQSTKEERSVLMTEQQQLLREKTK 335  fruit fly
Q00737  225 YTIYSREQQEIASFLDSLEEQRQTGVEDTDINRDRFIQGEKEMAQVDAEIAECKQQIEFLKVDKAQLEDERREASKALAQ 304  Aspergillus nidulan...
P47037  232 FTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAKLRESEISQKLT 311  Saccharomyces cerev...
Q12267  466 LEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSLKDKTK 545  Saccharomyces cerev...
Q90988  311 AKVRSDLDHRKQNLNSEENRLKELIKIMQEEFKAFTSKEKEIKKIKEGLNGLQEESKKDAEALASAQQHFNAVSAGLSSN 390  chicken
P38989  311 EISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKDYKMVQEQLSKQRDLYKRKEELVSTLTTGIS 390  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  336 LDLTIVDLNDEVQGDNKSKERADQELKNLKVTIAEREKELDDVKPKYEAMKRKEEDCSRELQLKEQKRKELYAKQGRGSQ 415  fruit fly
Q00737  305 VELQAKSLSDNQAAAQESKARHDESLKAVQSAIEERQTELKELVPRFISAKDAEDAARAKLTEAETARQRLYAKQGRNSR 384  Aspergillus nidulan...
P47037  312 NVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQKQRDLILKKGEYA 391  Saccharomyces cerev...
Q12267  546 NISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLK 625  Saccharomyces cerev...
Q90988  391 DSGQGTSLADQMMTCKNEISKAATEAKQAQMKLKYAQQELKTKQAEVKKMDGSYKEDQEAFEAIRKTKEKLQDEMKKLKY 470  chicken
P38989  391 STGAADGGYNAQLAKAKTELNEVSLAIKKSSMKMELLKKELLTIEPKLKEATKDNELNVKHVKQCQETCDKLRARLVEYG 470  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  416 FSSREDRDKWITNELKSISKQTRDKIAHHAKLVEDLKKDATSEKDLGQKIEEHSSELEQLRLQIDEHNKKYYELKKTKDQ 495  fruit fly
Q00737  385 FKNKSERDKWLQAEIKNNNASISSVQSVLSQTQEDINDIENDIALLEPETERLRQQIDGRGDTIQSVEQQVQAAKDERDR 464  Aspergillus nidulan...
P47037  392 RFKSKDERDTWIHSEIEELKSSIQNLNELESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQK 471  Saccharomyces cerev...
Q12267  626 DERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVA 705  Saccharomyces cerev...
Q90988  471 EEAEQEAHLAKKKQLSSEISSLRELCESIEAKHPYLRFEYKNPEKNWNPNCVKGLVVTLITVKDISTSKALEAVAGGKLY 550  chicken
P38989  471 FDPSRIKDLKQREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRYATALQTCAGG 550  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  496 HQSMRNELWRKETQMTQQLQTHKEELSRADQALRSMAGKPILNGCDSVRKVLDSFVERGGQSAEIARAYYGPVIENFSCD 575  fruit fly
Q00737  465 LMDQRKYVDWPRTSCATLTIHRELWREEAKLDSILINASNEVDRAERNLSQMMDHNTSRGIAAVRRIKRQHNLEGVYGTL 544  Aspergillus nidulan...
P47037  472 LSESLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDKYK 551  Saccharomyces cerev...
Q12267  706 ISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFdlvkpknpkfsnafysvlrd 785  Saccharomyces cerev...
Q90988  551 NIVVDTEATGKKILEKGQLKHRYTIIPLSKISANSIGHEIISLAKNLIGHREVHIAISLId------------------- 611  chicken
P38989  551 RLFNVVVQDSQTATQLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAIN-------------------- 610  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  576 KTIYTAVEVTAANRLFHHIVESEYEGTQILKEMNKLKLPGEVTFMPLNRLQVKIHDYPDDpdsipmiskl---------- 645  fruit fly
Q00737  545 AELFEVNDRYRTAVEVTAGQSLFHYVVDTDDTATKVLEILQHEKAGRVTFMPLNRLRTKPlnmpkasdtipmieklqy-- 622  Aspergillus nidulan...
P47037  552 TCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKFPSNTTTQiqftplikkikyeprfekav 631  Saccharomyces cerev...
Q12267  786 tlvaqnlkqannvaygkkrfrvvtvdgklidisgtmsgggnhvakglmklgtnqsdkvddytpeEVDKIERELSERENNF 865  Saccharomyces cerev...
Q90988  612 ----------------------------------------------------------------YNSELQKAMEYVFGTT 627  chicken
P38989  611 ----------------------------------------------------------------LIRFDESITKAMEFIF 626  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  646 ------------------------------------------------------kydeqhdkalRYIFGKTLICRNLERA 671  fruit fly
Q00737  623 -----------------------------------------------drayekafqhvfgktiiCPNLQVASQYARSHGV 655  Aspergillus nidulan...
P47037  632 k-------------------------------------------hvfgktivvkdlgqglklakKHKLNAITLDGDRADK 668  Saccharomyces cerev...
Q12267  866 RVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEY 945  Saccharomyces cerev...
Q90988  628 LVCSSMDNAKKVTFDKRIMRKTVTLQGDIFDPQGTLSGGASSHVTPILSKLKTMRDAEDELKIKTSQLEATEKELANLKN 707  chicken
P38989  627 GNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADLNHVTEELQT 706  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  672 TELAKSTGLDCVTLDGDQVSSKGSLTGGYFNTSRSRLEMQKKRTEYTSQIAEFEKKLSKLRNELKSTENNINSIVSEMQK 751  fruit fly
Q00737  656 NATTPEGDRSDKRGALTGGFHDSRQSRLDAVKNLAKWRDEYETKKSRGSEIRKELEELDQLITRAVGELQKLEQQRHQVQ 735  Aspergillus nidulan...
P47037  669 RGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKIDQVNGNIRKVSNDRESVLTNIEVYRTSLN 748  Saccharomyces cerev...
Q12267  946 NDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSERDVEL 1025 Saccharomyces cerev...
Q90988  708 MAEKYQHLKQQWEMKSEEAELLQTKIQQSAYHKQQEDLLALKKTIAECEETLKKTEESQRKAEEEYKALENKMKNAEAER 787  chicken
P38989  707 QYATSQKTKTIQSDLNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGECENEIKTKQMSLKKCQEEVSTIEKDMKEYD 786  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  752 TETKQGKSKDVFEKVQGEIRLMKEELVRIEQYRAPKERSLAQCKASLESMTSTKSSLEAELKQELMSTLSSQDQREIDQL 831  fruit fly
Q00737  736 NSSGPLRQELRSKRDLLQKQNDNLDAKRRALRNIEGNLAALKDQVDAFEAELSSPFHKALTDEEEARLESLNSNVQEYRR 815  Aspergillus nidulan...
P47037  749 TKKNEKLILEESLNAIILKLEKLNTNRTFAQEKLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEG 828  Saccharomyces cerev...
Q12267 1026 SSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKS 1105 Saccharomyces cerev...
Q90988  788 GKEIKNAQQKLNSAKKKADDSSRKMKEKQQEVEALVLELEQLKQEQASYKQQSEAAQQAIASLKEQVSALEAEAVKTRES 867  chicken
P38989  787 SDKGSKLNELKKELKLLAKELEEQESESERKYDLFQNLELETEQLSSELDSNKTLLHNHLKSIESLKLENSDLEGKIRGV 866  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  832 NDDIRRLNQENKEAFTQRMQFEVRKNKLDNLLINNLFRRRDELIQALQEISVEDRKRKLNNCKTELVSAEKRIKKVNSDL 911  fruit fly
Q00737  816 EYQELSGKRSELETRKSVLEVELRENLNPRLDQLLAQDADIADEDGQGNIKETQREQKRLTKVLDKLAQRLAQVDESMEQ 895  Aspergillus nidulan...
P47037  829 ITTTIDSLNAELESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQREIESLIAEETNN 908  Saccharomyces cerev...
Q12267 1106 EITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVS 1185 Saccharomyces cerev...
Q90988  868 LKNAENELSSEKGLMEERTKDIKAKSAKIEKYREQNNELQLSINALEHDINKYQQETADASSTLDKLLKEYKWIASEKEL 947  chicken
P38989  867 EDDLVTVQTELNEEKKRLMDIDDELNELETLIKKKQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDLRQKHEFLEDF 946  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  912 EEIEKRVMEAVQLQKELQQELETHVRKEKEAEENLNKDSKQLEKWSTKENMLNEKIDECTEKIASLGAVPLVDPSYTRMS 991  fruit fly
Q00737  896 ANSRVTELTQRNAESRRELEELAKSIEKHQRRMEKSMQKKAALTKQAAECAANIRDLGVLPDEAFTKYKNTDSNTVVKKL 975  Aspergillus nidulan...
P47037  909 KKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGLLPEDALVNDFSDITSDQLLQRLNDMNTEI 988  Saccharomyces cerev...
Q12267 1186 RGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILKKKRFD 1265 Saccharomyces cerev...
Q90988  948 FGQADTTYDFEANNPKETGQKLQKLLTKKEKLEKSLNMRAMNLLSEAEERYNDLMKKKRMVENDKIKILATIEELDRKKN 1027 chicken
P38989  947 DLVRNIVKQNEGIDLDTYRERSKQLNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKR 1026 Saccharomyces cerev...
P13456  195 --------------------------------------------------------------NYIKALKPVFERTLSELV 212  Pseudomonas putida
B4F0U7  197 --------------------------------------------------------------EYTEDIAKDIEETCQLFL 214  Proteus mirabilis H...
P0A7H0  194 --------------------------------------------------------------EYSAGIAADMADTCKQFL 211  Escherichia coli K-12
P43767  194 --------------------------------------------------------------EYAEALSPEIEQTCQLFL 211  Haemophilus influen...
Q24098  992 LKNIFKELEKANQHLKKYNHVNKKALDQFLSFSEQKEKLYRRKEELDIGDQKIHMLIQSLEMQKVEAIQFTFRQVAQNFT 1071 fruit fly
Q00737  976 HKVNEALKKYAHVNKKAFEQYNNFTKQRETLTSRREELDASQKSIDDLISVLDHRKDEAIERTFKQVSREFATIFEKLVP 1055 Aspergillus nidulan...
P47037  989 SGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLI 1068 Saccharomyces cerev...
Q12267 1266 EFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA-----LH 1340 Saccharomyces cerev...
Q90988 1028 KALHIAWEKVNKDFGSIFSMLLPGAKAMLVPSKKQNILDGLEFRVGLGDIWKENLTELSGGQRSLAALSLILA-----IL 1102 chicken
P38989 1027 ETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKDVTQGLEVKVKLGNIWKESLIELSGGQRSLIALSLIMA-----LL 1101 Saccharomyces cerev...
P13456  213 ELDGLTLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQKLVGMRII-AqghlvSQ 291  Pseudomonas putida
B4F0U7  215 PEFTLKVSFQRGWDKETDYAQLLERQFERDKVLSYTSLGAHKADLRIRANGTPVEDMLSRGQLKLLMCALRLAqgeyfTR 294  Proteus mirabilis H...
P0A7H0  212 PEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHGPHKADLRIRADGAPVEDTLSRGQLKLLMCALRLAqgeflTR 291  Escherichia coli K-12
P43767  212 PELEINVSFHQGWEKNADYYEILQQNFERDRALNYTFSGPQKADFRFKAQGLPVEDVLSRGQLKLLMCALRLAqgehlMK 291  Haemophilus influen...
Q24098 1072 KVFKKLVPMGAGFLILKTKDNEGDEMEKEVENSDAFTGIGIRVSFTGVEAEMREMNQLSGGQKSLVALALIFS-----IQ 1146 fruit fly
Q00737 1056 AGRGRLIIQRKTDRTQRAEDDLESEDEEAKHSVENYVGVGISVSFNSKHDDQQRIQQLSGGQKSLCALALVFA-----IQ 1130 Aspergillus nidulan...
P47037 1069 IHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILA-----IQ 1143 Saccharomyces cerev...
Q12267 1341 KYKPTPLYVMDEIDAALDFRNVSIVANYIK--ERTKNAQFIVISLRNNMFELA---QQLVGVYKRDNRTKS 1406 Saccharomyces cerevisiae S288c
Q90988 1103 LFKPAPIYILDEVDAALDLSHTQNIGQMLH--AHFKQSQFLVVSLKDGMFNNA---NVLYRTKF-VDGIST 1167 chicken
P38989 1102 QFRPAPMYILDEVDAALDLSHTQNIGHLIK--TRFKGSQFIVVSLKEGMFANA---NRVFRTRF-QDGTSV 1166 Saccharomyces cerevisiae S288c
P13456  292 ARRGHCIYLVDDLPSELDDQHRRALCRLLE--ELR--CQVFITCVDHELLREGwqtETPVALFHVEQGRIT 358  Pseudomonas putida
B4F0U7  295 KNGQRCLYLLDDFASELDANRRQLLAERLK--STQ--AQVFVSAITSGQVKDMl--DVNSRLFSVEHGKIE 359  Proteus mirabilis HI4320
P0A7H0  292 ESGRRCLYLIDDFASELDDERRGLLASRLK--ATQ--SQVFVSAISAEHVIDMs--DENSKMFTVEKGKIT 356  Escherichia coli K-12
P43767  292 EKQRHCIFLIDDFASELDQYKRALLAERLQ--QSG--SQVFVTAITQRQLKEMq--VENKKMFSVHNGIIN 356  Haemophilus influenzae Rd KW20
Q24098 1147 KCDPAPFYLFDEIDQALDAMHRKAVANMIH--ELSDTAQFITTTFRPELLENA---HKFYGVRF-RNKVSH 1211 fruit fly
Q00737 1131 ACDPAPFYLFDEIDANLDAQYRTAVAQMLKtiSDSTNGQFICTTFRPEMLHVA---EKCYGVSF-RQKAST 1197 Aspergillus nidulans FGSC A4
P47037 1144 MVDPASFYLFDEIDAALDKQYRTAVATLLK--ELSKNAQFICTTFRTDMLQVA---DKFFRVKY-ENKIST 1208 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap