Conserved Protein Domain Family
SMC_N

?
pfam02463: SMC_N 
RecF/RecN/SMC N terminal domain
This domain is found at the N-terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination.
Statistics
?
Aligned: 28 rows
Threshold Bit Score: 130.862
Threshold Setting Gi: 132249
Created: 30-Apr-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12267  155 FINELVLENFKSYAgKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRLSDLIHKs-EAFPSLQSCSV 232  Saccharomyces cerev...
P73340    3 YVKRIELSHFKSFG-GTTAIPFLPGFTVVSGPNGSGKSNILDALLFCLGLATSkGMRAERLPDLVNNtfKGNRGSSEASV 81   Synechocystis sp. P...
Q90988    2 YIKSIVLEGFKSYAqRTEIRDFDPLFNAITGLNGSGKSNILDSICFLLGISNLsQVRASSLQDLVYk--NGQAGVNKATV 79   chicken
P38989    2 KVEELIIDGFKSYAtRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMsTVRASSLQDLIYk--RGQAGVTKASV 79   Saccharomyces cerev...
P13456    2 SLRRIMVTAVRNL--HPVTLLPSPRINILYGANGSGKTSVLEAV-HLLG--LArSFRSTRLNPVIQY--EQAACTVFGEV 74   Pseudomonas putida
B4F0U7    2 ILSRLLIRHFRNI--EQADLPLADGFNFLVGPNGSGKTSILEAI-YTLG--HGrAFRSAQANRVIQH--DENAFILHGRL 74   Proteus mirabilis H...
P0A7H0    2 SLTRLLIRDFRNI--ETADLALSPGFNFLVGANGSGKTSVLEAI-YTLG--HGrAFRSLQIGRVIRH--EQEAFVLHGRL 74   Escherichia coli K-12
P43767    2 AISRLLVEKFRNL--TAVDLDFDPCFNFLIGNNGSGKTSLLEAI-FYLG--HGrSFKSAVTNRIISY--DEPHFTLFGQI 74   Haemophilus influen...
Q24098   33 HIKQIIIQGFKSYKdQTVVEPFDKRHNVVVGRNGSGKSNFFYAIQFVLSD-EFtHLRPEQRQSLLHE--GTGARVISAYV 109  fruit fly
Q00737    2 YVKQIIIQGFKSYKdQTVIEPFSPKHNVIVGRNGSGKSNFFAAIRFVLS-DAYtHLGREERQALLHE--GSGSAVMSAYV 78   Aspergillus nidulan...
Q12267  233 AVHFqy----viDESSGT-------SRIDEEKpgLIITRKAFKNNS---SKYYINEKESSY-TEVTKLLKNEGIDLDHKR 297  Saccharomyces cerev...
P73340   82 SVTFelhdgenlSEPGANhngngngAKISKEW--TVTRRLKVTKGGnysSNYYINGETATV-TELHEQLNELRIYPEGYN 158  Synechocystis sp. P...
Q90988   80 SITF--------DNSDKKns---plGFENNDE--ITITRQVIVGGR---NKYLINGMNASN-NRVQDLFGSVGLNVNNPH 142  chicken
P38989   80 TIVF--------DNTDKSns---piGFTNSPQ--ISVTRQVVLGGT---SKYLINGHRAPQ-QSVLQLFQSVQLNINNPN 142  Saccharomyces cerev...
P13456   75 QLT-----------EGGT----------------SNLGVSRERQGE---FTIRIDGQNARQ-AQLAELLPLQLINPDSFR 123  Pseudomonas putida
B4F0U7   75 SGL---------DEESRG----------------YSIGLSKDREGN---STVRIDGSDGHKiAELAKLLPMQLITPEGFT 126  Proteus mirabilis H...
P0A7H0   75 QG------------EERE----------------TAIGLTKDKQGD---SKVRIDGTDGHKvAELAHLMPMQLITPEGFT 123  Escherichia coli K-12
P43767   75 QE------------SQHQ----------------WSIGLQKLRQGN---TLVKINGEDGNKiSDLAHLLPMQLITPEGLT 123  Haemophilus influen...
Q24098  110 EIIF--------DNSDNR-------VPIDKEE--IFLRRVIGAKKD----QYFLNKKVVPR-NEVVNLLESAGFSSSNPY 167  fruit fly
Q00737   79 EIIF--------DNSDER-------FPTGKPE--LVLRRTIGLKKD----EYTLDRKNATK-NDVMNLLESAGFSRSNPY 136  Aspergillus nidulan...
Q12267  298 FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKET 377  Saccharomyces cerev...
P73340  159 IVLQGDVTRIITMNSKERREIIDELAGVAEFDRKIVKTKETLTEVQDREERCQIIATELERTLERLAADRQKAEKYQALR 238  Synechocystis sp. P...
Q90988  143 FLIMQGQITKVLNMKPTEILAMIEEAAGTRMYECKKITAHKTIEKKESKLDEIRRIITEEISPTLEKLKEARASYLEYQK 222  chicken
P38989  143 FLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREKAERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQS 222  Saccharomyces cerev...
P13456  124 LLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALRQRNSWLRHGTLDPASQAAWDRELCLRSAEIDEYRR--------- 194  Pseudomonas putida
B4F0U7  127 LLNGGPKYRRAFIDWGCFHNEPRFFAAWSDLKRVLKQRNAALRQASSYRQLLPWDKELILLTEQISQWRA---------- 196  Proteus mirabilis H...
P0A7H0  124 LLNGGPKYRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRA---------- 193  Escherichia coli K-12
P43767  124 LLNGGPSYRRAFLDWGLFHHQTSFYSAWSNLNRLLKQRNAALAQNQPYSAIKIWDVELAKLAHQVSEWRA---------- 193  Haemophilus influen...
Q24098  168 YIVKQGKINQMATAADSYRLKLLREVAGTRVYDERKEESLNLLRETDSKVEKISEYLKTIEDRLQTLEEEKEELKEYQKW 247  fruit fly
Q00737  137 YIVPQGRVTALTNMKDSERLNLLKEVAGTQVYEARRAESLKIMHETNSKREKIDELLDFINERLAELEEEKDELRNFQEK 216  Aspergillus nidulan...
Q12267  378 ALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEK 457  Saccharomyces cerev...
P73340  239 QQVQEKQGWAKVIQYKAVEQQRQKLWGQLERDREQSQQIQQALDQRSQAIQTQQTELEKLNAQVKALGEEEQLAVAAQLA 318  Synechocystis sp. P...
Q90988  223 MTREVENLRRIYVAFQYVRAEEIKDRSTNALKEAQANKKKIFESMAENEKKVKELAQQIEETEKKNNEEFGAKLHSLEAA 302  chicken
P38989  223 TQTDLEKTERIVVSYEYYNIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISKLE 302  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  248 DKTRRTLEYIRYETELKDTKKALDELQLQRKSSSDKKKIYNIEIQKAQEKIKDVQKNLKEAKKKVQSTKEERSVLMTEQQ 327  fruit fly
Q00737  217 DKERRCLEYTIYSREQQEIASFLDSLEEQRQTGVEDTDINRDRFIQGEKEMAQVDAEIAECKQQIEFLKVDKAQLEDERR 296  Aspergillus nidulan...
Q12267  458 TLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIK 537  Saccharomyces cerev...
P73340  319 TQKAQRDQLQQRYNDGDRQITNHQQQVGQIQAEISQSQQQFLHIQQEKSFHNTQTLPQLEAAVQTSQQQLEQLRHQAQAI 398  Synechocystis sp. P...
Q90988  303 FSELQRVDAKVRSDLDHRKQNLNSEENRLKELIKIMQEEFKAFTSKEKEIKKIKEGLNGLQEESKKDAEALASAQQHFNA 382  chicken
P38989  303 NKENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKDYKMVQEQLSKQRDLYKRKEELV 382  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  328 QLLREKTKLDLTIVDLNDEVQGDNKSKERADQELKNLKVTIAEREKELDDVKPKYEAMKRKEEDCSRELQLKEQKRKELY 407  fruit fly
Q00737  297 EASKALAQVELQAKSLSDNQAAAQESKARHDESLKAVQSAIEERQTELKELVPRFISAKDAEDAARAKLTEAETARQRLY 376  Aspergillus nidulan...
Q12267  538 LSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDLILDL 617  Saccharomyces cerev...
P73340  399 ASASEAWVQEQTQLSRTVNQLQDELIPQRSQLAQLEERQQQLLTNLAELTPLLTKVSVELEEKQFAQGQFNFQGEALTSQ 478  Synechocystis sp. P...
Q90988  383 VSAGLSSNDSGQGTSLADQMMTCKNEISKAATEAKQAQMKLKYAQQELKTKQAEVKKMDGSYKEDQEAFEAIRKTKEKLQ 462  chicken
P38989  383 STLTTGISSTGAADGGYNAQLAKAKTELNEVSLAIKKSSMKMELLKKELLTIEPKLKEATKDNELNVKHVKQCQETCDKL 462  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  408 AKQGRGSQFSSREDRDKWITNELKSISKQTRDKIAHHAKLVEDLKKDATSEKDLGQKIEEHSSELEQLRLQIDEHNKKYY 487  fruit fly
Q00737  377 AKQGRNSRFKNKSERDKWLQAEIKNNNASISSVQSVLSQTQEDINDIENDIALLEPETERLRQQIDGRGDTIQSVEQQVQ 456  Aspergillus nidulan...
Q12267  618 KKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGV 697  Saccharomyces cerev...
P73340  479 IQTLASDLAQLEQERSLLQETQTRLLKEQQEKQRQLDKLEAASQAQQEVQGTYATKVILQSDLPGVCGLVAQLGQVEPQY 558  Synechocystis sp. P...
Q90988  463 DEMKKLKYEEAEQEAHLAKKKQLSSEISSLRELCESIEAKHPYLRFEYKNPEKNWNPNCVKGLVVTLITVKDISTSKALE 542  chicken
P38989  463 RARLVEYGFDPSRIKDLKQREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRYAT 542  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  488 ELKKTKDQHQSMRNELWRKETQMTQQLQTHKEELSRADQALRSMAGKPILNGCDSVRKVLDSFVERGGQSAEIARAYYGP 567  fruit fly
Q00737  457 AAKDERDRLMDQRKYVDWPRTSCATLTIHRELWREEAKLDSILINASNEVDRAERNLSQMMDHNTSRGIAAVRRIKRQHN 536  Aspergillus nidulan...
Q12267  698 IDDSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFdlvkpknpkfsn 777  Saccharomyces cerev...
P73340  559 QLALEIAAGGRLGFLVVEDDGVAAAGIEILKQAKAGRATFLPLNKIRPPKGQNPNLSYAHGYIDLAVNlidgdr------ 632  Synechocystis sp. P...
Q90988  543 AVAGGKLYNIVVDTEATGKKILEKGQLKHRYTIIPLSKISANSIGHEIISLAKNLIGHREVHIAISLId----------- 611  chicken
P38989  543 ALQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAIN------------ 610  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  568 VIENFSCDKTIYTAVEVTAANRLFHHIVESEYEGTQILKEMNKLKLPGEVTFMPLNRLQVKIHDYPDDpdsipmiskl-- 645  fruit fly
Q00737  537 LEGVYGTLAELFEVNDRYRTAVEVTAGQSLFHYVVDTDDTATKVLEILQHEKAGRVTFMPLNRLRTKPlnmpkasdtipm 616  Aspergillus nidulan...
Q12267  778 afysvlrdtlvaqnlkqannvaygkkrfrvvtvdgklidisgtmsgggnhvakglmklgtnqsdkvddytpeEVDKIERE 857  Saccharomyces cerev...
P73340  633 -------------------------------------------------------------------ryadiFAFIFGNT 645  Synechocystis sp. P...
Q90988  612 ------------------------------------------------------------------------YNSELQKA 619  chicken
P38989  611 ------------------------------------------------------------------------LIRFDESI 618  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  646 --------------------------------------------------------------kydeqhdkalRYIFGKTL 663  fruit fly
Q00737  617 ieklqy-------------------------------------------------drayekafqhvfgktiiCPNLQVAS 647  Aspergillus nidulan...
Q12267  858 LSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKN 937  Saccharomyces cerev...
P73340  646 IVFDTLVNARNHLGKHRIVTLEGDLLEASGAMSGGSRNQRSGLRFGTMVSEDTAEVKQLRQRLQDIQQVQGRNEELLLER 725  Synechocystis sp. P...
Q90988  620 MEYVFGTTLVCSSMDNAKKVTFDKRIMRKTVTLQGDIFDPQGTLSGGASSHVTPILSKLKTMRDAEDELKIKTSQLEATE 699  chicken
P38989  619 TKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADLN 698  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  664 ICRNLERATELAKSTGLDCVTLDGDQVSSKGSLTGGYFNTSRSRLEMQKKRTEYTSQIAEFEKKLSKLRNELKSTENNIN 743  fruit fly
Q00737  648 QYARSHGVNATTPEGDRSDKRGALTGGFHDSRQSRLDAVKNLAKWRDEYETKKSRGSEIRKELEELDQLITRAVGELQKL 727  Aspergillus nidulan...
Q12267  938 LERLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQ 1017 Saccharomyces cerev...
P73340  726 TVRSRQLTQQLMEMRQQQREAQLHGEQTERDIARLSQQQTQINQQQINQQQKLAELQQNLALLQQSLPPLEQQLASAQQQ 805  Synechocystis sp. P...
Q90988  700 KELANLKNMAEKYQHLKQQWEMKSEEAELLQTKIQQSAYHKQQEDLLALKKTIAECEETLKKTEESQRKAEEEYKALENK 779  chicken
P38989  699 HVTEELQTQYATSQKTKTIQSDLNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGECENEIKTKQMSLKKCQEEVSTI 778  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  744 SIVSEMQKTETKQGKSKDVFEKVQGEIRLMKEELVRIEQYRAPKERSLAQCKASLESMTSTKSSLEAELKQELMSTLSSQ 823  fruit fly
Q00737  728 EQQRHQVQNSSGPLRQELRSKRDLLQKQNDNLDAKRRALRNIEGNLAALKDQVDAFEAELSSPFHKALTDEEEARLESLN 807  Aspergillus nidulan...
Q12267 1018 NSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLN 1097 Saccharomyces cerev...
P73340  806 LTALETSQTHQQWQTIQIQIRTVEAEYQRQLQALRQGEDHLKDLQNSSQRLEEKIAQAQEKIAQHQAQDLTLAQEQEQLK 885  Synechocystis sp. P...
Q90988  780 MKNAEAERGKEIKNAQQKLNSAKKKADDSSRKMKEKQQEVEALVLELEQLKQEQASYKQQSEAAQQAIASLKEQVSALEA 859  chicken
P38989  779 EKDMKEYDSDKGSKLNELKKELKLLAKELEEQESESERKYDLFQNLELETEQLSSELDSNKTLLHNHLKSIESLKLENSD 858  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  824 DQREIDQLNDDIRRLNQENKEAFTQRMQFEVRKNKLDNLLINNLFRRRDELIQALQEISVEDRKRKLNNCKTELVSAEKR 903  fruit fly
Q00737  808 SNVQEYRREYQELSGKRSELETRKSVLEVELRENLNPRLDQLLAQDADIADEDGQGNIKETQREQKRLTKVLDKLAQRLA 887  Aspergillus nidulan...
Q12267 1098 SLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNI 1177 Saccharomyces cerev...
P73340  886 IALAEMNGAIQTTEAQLAKLSEKLGSTKQERDRLETQLNQLRSQQQEQQWQWEKLQTNQQEYQENLTQLQTQLEALEQDL 965  Synechocystis sp. P...
Q90988  860 EAVKTRESLKNAENELSSEKGLMEERTKDIKAKSAKIEKYREQNNELQLSINALEHDINKYQQETADASSTLDKLLKEYK 939  chicken
P38989  859 LEGKIRGVEDDLVTVQTELNEEKKRLMDIDDELNELETLIKKKQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDLRQ 938  Saccharomyces cerev...
P13456      -------------------------------------------------------------------------------- Pseudomonas putida
B4F0U7      -------------------------------------------------------------------------------- Proteus mirabilis H...
P0A7H0      -------------------------------------------------------------------------------- Escherichia coli K-12
P43767      -------------------------------------------------------------------------------- Haemophilus influen...
Q24098  904 IKKVNSDLEEIEKRVMEAVQLQKELQQELETHVRKEKEAEENLNKDSKQLEKWSTKENMLNEKIDECTEKIASLGAVPLV 983  fruit fly
Q00737  888 QVDESMEQANSRVTELTQRNAESRRELEELAKSIEKHQRRMEKSMQKKAALTKQAAECAANIRDLGVLPDEAFTKYKNTD 967  Aspergillus nidulan...
Q12267 1178 DETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLG 1257 Saccharomyces cerev...
P73340  966 PDPWPEIPLLQDRDEANLDFANILEELERSIRNGQKRLEAMEPVNMLALQEYEKTEARLGELSEKLQTIAGERTELLLRI 1045 Synechocystis sp. P...
Q90988  940 WIASEKELFGQADTTYDFEANNPKETGQKLQKLLTKKEKLEKSLNMRAMNLLSEAEERYNDLMKKKRMVENDKIKILATI 1019 chicken
P38989  939 KHEFLEDFDLVRNIVKQNEGIDLDTYRERSKQLNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETI 1018 Saccharomyces cerev...
P13456  195 ----------------------------------------------------------------------NYIKALKPVF 204  Pseudomonas putida
B4F0U7  197 ----------------------------------------------------------------------EYTEDIAKDI 206  Proteus mirabilis H...
P0A7H0  194 ----------------------------------------------------------------------EYSAGIAADM 203  Escherichia coli K-12
P43767  194 ----------------------------------------------------------------------EYAEALSPEI 203  Haemophilus influen...
Q24098  984 DPSYTRMSLKNIFKELEKANQHLKKYNHVNKKALDQFLSFSEQKEKLYRRKEELDIGDQKIHMLIQSLEMQKVEAIQFTF 1063 fruit fly
Q00737  968 SNTVVKKLHKVNEALKKYAHVNKKAFEQYNNFTKQRETLTSRREELDASQKSIDDLISVLDHRKDEAIERTFKQVSREFA 1047 Aspergillus nidulan...
Q12267 1258 ILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1337 Saccharomyces cerev...
P73340 1046 ENFTTLRRRSFQDAFDAVNKNFQIIFAELSDGDGYLQLDDAEDPFNGGLNLVAHPKGKPVRRLSSMSGGEKSLTALSFIF 1125 Synechocystis sp. P...
Q90988 1020 EELDRKKNKALHIAWEKVNKDFGSIFSMLLPGAKAMLVPSKKQNILDGLEFRVGLGDIWKENLTELSGGQRSLAALSLIL 1099 chicken
P38989 1019 SKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKDVTQGLEVKVKLGNIWKESLIELSGGQRSLIALSLIM 1098 Saccharomyces cerev...
P13456  205 ERTLSELVELDGLTLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQKLVGMRII- 283  Pseudomonas putida
B4F0U7  207 EETCQLFLPEFTLKVSFQRGWDKETDYAQLLERQFERDKVLSYTSLGAHKADLRIRANGTPVEDMLSRGQLKLLMCALRL 286  Proteus mirabilis H...
P0A7H0  204 ADTCKQFLPEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHGPHKADLRIRADGAPVEDTLSRGQLKLLMCALRL 283  Escherichia coli K-12
P43767  204 EQTCQLFLPELEINVSFHQGWEKNADYYEILQQNFERDRALNYTFSGPQKADFRFKAQGLPVEDVLSRGQLKLLMCALRL 283  Haemophilus influen...
Q24098 1064 RQVAQNFTKVFKKLVPMGAGFLILKTKDNEGDEMEKEVENSDAFTGIGIRVSFTGVEAEMREMNQLSGGQKSLVALALIF 1143 fruit fly
Q00737 1048 TIFEKLVPAGRGRLIIQRKTDRTQRAEDDLESEDEEAKHSVENYVGVGISVSFNSKHDDQQRIQQLSGGQKSLCALALVF 1127 Aspergillus nidulan...
Q12267 1338 A-----LHKYKPTPLYVMDEIDAALDFRNVSIVANYIK--ERTKNAQFIVISLRNNMFELA---QQLVGVYKRDNRTKS 1406 Saccharomyces cerevi...
P73340 1126 A-----LQRYRPSPFYGFDEVDMFLDGANVEKLSKMVR--KQAQQAQFIVVSLRRPMIEAA---ERTIGVTQARGAHTQ 1194 Synechocystis sp. PC...
Q90988 1100 A-----ILLFKPAPIYILDEVDAALDLSHTQNIGQMLH--AHFKQSQFLVVSLKDGMFNNA---NVLYRTKF-VDGIST 1167 chicken
P38989 1099 A-----LLQFRPAPMYILDEVDAALDLSHTQNIGHLIK--TRFKGSQFIVVSLKEGMFANA---NRVFRTRF-QDGTSV 1166 Saccharomyces cerevi...
P13456  284 AqghlvSQARRGHCIYLVDDLPSELDDQHRRALCRLLE--ELR--CQVFITCVDHELLREGwqtETPVALFHVEQGRIT 358  Pseudomonas putida
B4F0U7  287 AqgeyfTRKNGQRCLYLLDDFASELDANRRQLLAERLK--STQ--AQVFVSAITSGQVKDMl--DVNSRLFSVEHGKIE 359  Proteus mirabilis HI...
P0A7H0  284 AqgeflTRESGRRCLYLIDDFASELDDERRGLLASRLK--ATQ--SQVFVSAISAEHVIDMs--DENSKMFTVEKGKIT 356  Escherichia coli K-12
P43767  284 AqgehlMKEKQRHCIFLIDDFASELDQYKRALLAERLQ--QSG--SQVFVTAITQRQLKEMq--VENKKMFSVHNGIIN 356  Haemophilus influenz...
Q24098 1144 S-----IQKCDPAPFYLFDEIDQALDAMHRKAVANMIH--ELSDTAQFITTTFRPELLENA---HKFYGVRF-RNKVSH 1211 fruit fly
Q00737 1128 A-----IQACDPAPFYLFDEIDANLDAQYRTAVAQMLKtiSDSTNGQFICTTFRPEMLHVA---EKCYGVSF-RQKAST 1197 Aspergillus nidulans...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap