1NIP,1DAM,1DJ2,1FPM,1IHU,1IHU,1ION,1NIJ,1NP6,1OKK,1P9B,2AD5,2BEK,2HF8,2OXR,2P67,3BFV,3EA0,3FKQ,3Q9L,4HI0,4RZ3,3KJI,3VX3,5HCI


Conserved Protein Domain Family
SIMIBI

?
cd01983: SIMIBI 
Click on image for an interactive view with Cn3D
SIMIBI (signal recognition particle, MinD and BioD)-class NTPases
SIMIBI (after signal recognition particle, MinD, and BioD), consists of signal recognition particle (SRP) GTPases, the assemblage of MinD-like ATPases, which are involved in protein localization, chromosome partitioning, and membrane transport, and a group of metabolic enzymes with kinase or related phosphate transferase activity. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Statistics
?
PSSM-Id: 349751
Aligned: 29 rows
Threshold Bit Score: 33.5584
Created: 12-Dec-2003
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active site
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:3Q9L; Escherichia coli MinD-ATP complex, contacts 4A
    View structure with Cn3D
  • Structure:2OXR; Pyrococcus abyssi Pab0955 with bound Mg-GDP, contact 4A
    View structure with Cn3D
  • Structure:1P9B; Plasmodium falciparum adenylosuccinate synthetase with bound 6-phosphoryl IMP, GDP, Mg2+ and the aspartate analogue, hadacidin; contacts 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ######                     #                                       
1NIP_A      3 RQCAIYGk----gGIGKSTTTQNLVaalaemgkkVMIVGCDpkadstrlilhskaqntimemaaeagtvedleledvlka 78  Azotobacter vinela...
1FPM_A     58 KLILVTAitptpaGEGKTTTSVGLTdalarlgkrVMVCLREpslgpsfgikggaagggyaqvvpmedinlhftgdihavt 137 Moorella thermoace...
1NIJ_A      5 AVTLLTGf----lGAGKTTLLRHILneqh--gykIAVIENEfgevsvddqligdratqiktltngci------------- 65  Escherichia coli
1NP6_A      7 PLLAFAAw----sGTGKTTLLKKLIpalcargirPGLIKHThhdmdvdkpgkdsyelrkagaaqtivasq---------- 72  Escherichia coli
1P9B_A     15 NVVAILGaq--wgDEGKGKIIDMLSey------sDITCRFNgganaghtisvndkkyalhllpcgvlydnnisvlgngmv 86  malaria parasite P...
2AD5_A      4 NYIFVTGgv--vsSLGKGIAAASLAailearglnVTIMKLDpyinvdpgtmspiqhgevfvtedgaetdldlghyerfir 81  Escherichia coli
2HF8_A     39 VAFDFXGa----iGSGKTLLIEKLIdnlk-dkykIACIAGDviakfdaerxekhgakvvplntg---------------- 97  Methanocaldococcus...
3Q9L_A      3 RIIVVTSgk---gGVGKTTSSAAIAtglaqkgkkTVVIDFAiglrnldlimgcerrvvydfvnviqgdatlnqalikd-- 77  Escherichia coli K-12
4HI0_E      2 VKIGVCGp----vGSGKTALIEALTrhms-kdydMAVITNDiytkedaefmcknsvmpreriigvetgg----------- 65  Helicobacter pylor...
Q7N2T7      3 LSLMLQGta---sDVGKSVLVAGLCrifvqdgyrCAPFKSQnmalnsgitingeemgraqifqaeaagiepdvrmnpvll 79  Photorhabdus lumin...
Feature 1                                                                                     
1NIP_A     79 g------------------------------------------------------------------------------- 79  Azotobacter vinela...
1FPM_A    138 yahnllaamvdnhlqqgnvlnidprtitwrrvidlndralrniviglggkangvpretgfdisvasevmaclclasdlmd 217 Moorella thermoace...
1NIJ_A        --------------------------------------------------------------------------------     Escherichia coli
1NP6_A        --------------------------------------------------------------------------------     Escherichia coli
1P9B_A     87 ihvkslmeeiesvggklldrlylsnkahilfdihqiidsiqetkklkeg---------------------kqigttkrgi 145 malaria parasite P...
2AD5_A     82 tkmsrrn------------------------------------------------------------------------- 88  Escherichia coli
2HF8_A        --------------------------------------------------------------------------------     Methanocaldococcus...
3Q9L_A        --------------------------------------------------------------------------------     Escherichia coli K-12
4HI0_E        --------------------------------------------------------------------------------     Helicobacter pylor...
Q7N2T7     80 kpts---------------------------------------------------------------------------- 83  Photorhabdus lumin...
Feature 1                                                                                     
1NIP_A     80 --------------------------------------yggvkcvesggpepgvgcagrgvitainfleeegayeddlDF 121 Azotobacter vinela...
1FPM_A    218 lkerfsrivvgytydgkpvtagdleaqgsmallmkdaikpnlvqtlentpafihggpfaniahgcnsiiatktalklaDY 297 Moorella thermoace...
1NIJ_A     66 ----------------------------------------------------ccsrsneledalldlldnldkgniqfDR 93  Escherichia coli
1NP6_A     73 -------------------------------------------------qrwalmtetpdeeeldlqflasrmdtsklDL 103 Escherichia coli
1P9B_A    146 gpcystkasrigirlgtlknfenfknmysklidhlmdlyniteydkekelnlfynyhiklrdrivdvisfmntnlennKK 225 malaria parasite P...
2AD5_A     89 --------------------------------nfttgriysdvlrkerrgdylgatvqviphitnaikervleggeghDV 136 Escherichia coli
2HF8_A     98 --------------------------------------------------------kechldahlvghaledlnldeiDL 121 Methanocaldococcus...
3Q9L_A     78 -----------------------------------------krtenlyilpasqtrdkdaltregvakvlddlkamdfEF 116 Escherichia coli K-12
4HI0_E     66 ---------------------------------------------------cphtairedasmnleaveemhgrfpnlEL 94  Helicobacter pylor...
Q7N2T7     84 -----------------------------------erkaqvvlmgkvacsmnaveyhqykpslqqqicevfhslaseyDV 128 Photorhabdus lumin...
Feature 1        #                                                                            
1NIP_A    122 VFYDVlgdvvcggfa-------------------mpirenkaqEIYIVCSgemmamyaannisk---------------- 166 Azotobacter vinela...
1FPM_A    298 VVTEAgfgadlgaekfy--------------dvkcryagfkpdATVIVATvralkmhggvpksdlatenlea-------- 355 Moorella thermoace...
1NIJ_A     94 LVIECtgmadpgpiiqtf------------fshevlcqrylldGVIALVDavhadeqmnqf------------------- 142 Escherichia coli
1NP6_A    104 ILVEGfkh--------------------------------eeiAKIVLFRdgaghrpee--------------------- 130 Escherichia coli
1P9B_A    226 VLIEGanaamldidfgtypyvtsscttvggvfsglgihhkklnLVVGVVKsyltrvgcgpfltelnndvgqylrekghey 305 malaria parasite P...
2AD5_A    137 VLVEIggtvgdieslpfle----------airqmaveigrehtLFMHLTLvpymaasgevktkpt--------------- 191 Escherichia coli
2HF8_A    122 LFIENvgnlicpa-----------------------dfdlgthKRIVVISttegddtiek-------------------- 158 Methanocaldococcus...
3Q9L_A    117 IVCDSpagietga----------------------lmalyfadEAIITTNpevssvrdsdrilgil-------------- 160 Escherichia coli K-12
4HI0_E     95 LLIESggdnlsat-----------------------fnpeladFTIFVIDvaegdkiprk-------------------- 131 Helicobacter pylor...
Q7N2T7    129 IVLEGagspaeinlrdr--------------divnmgmaemvdAPVLLVAdidrggvfaaiygt---------------- 178 Photorhabdus lumin...
Feature 1                                     ##
1NIP_A    167 --------------givkyansgsvrlgGLICNS 186 Azotobacter vinelandii
1FPM_A    356 ------lregfanlekhienigkfgvpaVVAINA 383 Moorella thermoacetica
1NIJ_A    143 -----------------tiaqsqvgyadRILLTK 159 Escherichia coli
1NP6_A    131 --------------------lvidrhviAVASDV 144 Escherichia coli
1P9B_A    306 gtttkrprrcgwldipmllyvkcinsidMINLTK 339 malaria parasite P. falciparum
2AD5_A    192 -------------qhsvkellsigiqpdILICRS 212 Escherichia coli
2HF8_A    159 -------------------hpgixktadLIVINK 173 Methanocaldococcus jannaschii
3Q9L_A    161 ------------asksrraengeepikeHLLLTR 182 Escherichia coli K-12
4HI0_E    132 -------------------ggpgitrsdLLVINK 146 Helicobacter pylori G27
Q7N2T7    179 --------------lallrpaekarvkgVIINKF 198 Photorhabdus luminescens subsp. laumondii

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap