2ANR,2ANN


Conserved Protein Domain Family
KH-I_NOVA_rpt1

?
cd22435: KH-I_NOVA_rpt1 
first type I K homology (KH) RNA-binding domain found in the family of neuro-oncological ventral antigen (Nova)
The family includes two related neuronal RNA-binding proteins, Nova-1 and Nova-2. Nova-1, also called onconeural ventral antigen 1, or paraneoplastic Ri antigen, or ventral neuron-specific protein 1, may regulate RNA splicing or metabolism in a specific subset of developing neurons. It interacts with RNA containing repeats of the YCAY sequence. It is a brain-enriched splicing factor regulating neuronal alternative splicing. Nova-1 is involved in neurological disorders and carcinogenesis. Nova-2, also called astrocytic NOVA1-like RNA-binding protein, is a neuronal RNA-binding protein expressed in a broader central nervous system (CNS) distribution than Nova-1. It functions in neuronal RNA metabolism. NOVA family proteins contain three K-homology (KH) RNA-binding domains. The model corresponds to the first one.
Statistics
?
PSSM-Id: 411863
Aligned: 33 rows
Threshold Bit Score: 100.69
Created: 17-Jul-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
RNA bindingGXXG motif
Conserved site includes 17 residues -Click on image for an interactive view with Cn3D
Feature 1:RNA binding site [nucleic acid binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    ### #####  ##         ### ###        #                       
2ANR_A         5 QYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIR 77  human
Q8ILU3        18 LCFVKLLINNLVAGSVIGKHGSIITSIENKTGCSLKLSPNNSYFPNTQERVLVLCGKIDQIKDALLIILDKIK 90  Plasmodium falciparum 3D7
XP_002775983  17 RCSCKLLVTHKQAGAIIGKSGSEISHMEQAAKVSIKVSPSGSFFPGTQERVLVIFGESMNIREVEMMGVGLEP 89  Perkinsus marinus ATCC...
CBN78891      66 RFGLKLLVSNSMAGTLIGKGGTRICEIKDECLADIKVTPNGRFYPGTHERVVLVVGEPGSVQMACDRIVTTIY 138 Ectocarpus siliculosus
EPR63774      17 PCYLKMIVNNVAAGAIIGKNGIAIAAMEQQTGCALKLSPLNAFYPGTQDRVLVMSGEQEQVNNALVLILGKIK 89  Toxoplasma gondii GT1
Q9LZ82        34 PTHIRFLVSNAAAGSVIGKGGSTITEFQAKSGARIQLSRNQEFFPGTTDRIIMISGSIKEVVNGLELILDKLH 106 thale cress
XP_005839430  35 QMALKILIGNKSAGSVIGKAGATINSIKDTSGAKVKVSSNSETFPGTADRIVLISGKVETVLSAAKMVISEMY 107 Guillardia theta CCMP2712
RYG63609       8 RISIKFLLNNSMTGTLIGAGGKAIKELMACTKARVQVSGTSETYPGSSDRVILVSGDPEAVEETQKLVWEMLA 80  archaeon
XP_002371047  64 ACYVKMLISNQLAGMIIGNTGQEIKHLKQVTGAKIVLSPHGMYFPGTTERLVAAEGTERAVFQVVDWIIDRMD 136 Toxoplasma gondii ME49
EDQ92704      11 GSAIKLLIPAKCAGGVIGRGGENISKLQEETGLHVKLSQTREFYPGTAERTCLIQGEPTRLIVGVNRVLDIIV 83  Monosiga brevicollis MX1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap