2RVB,2M14


Conserved Protein Domain Family
sm_acid_XPC-like

?
cd21393: sm_acid_XPC-like 
small acidic domain of Xeroderma pigmentosum group C complementing protein and similar proteins
This model represents the small acidic domain of mammalian Xeroderma pigmentosum group C complementing protein (XPC), yeast Rad4, and similar proteins. XPC/Rad4 recruits transcription/repair factor IIH (TFIIH) to the nucleotide excision repair (NER) complex through interactions with its p62/Tfb1 and XPB/Ssl2 TFIIH subunits. Global genome repair (GGR), one of two NER initiation pathways in mammals, starts with DNA lesion detection by XPC. XPC is a structure specific DNA-binding factor that recognizes distortion of the damaged DNA double helix and recruits the TFIIH complex onto the lesion to open up the damaged DNA. The small acidic domain of XPC/Rad4 interacts with the pleckstrin homology (PH) domain of the p62/Tfb1 subunit of TFIIH.
Statistics
?
PSSM-Id: 411063
Aligned: 12 rows
Threshold Bit Score: 27.0658
Created: 17-Aug-2020
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
 
PH domain
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:PH domain interface [polypeptide binding site]
Evidence:
  • Comment:The small acidic region of XPC/Rad4 binds to the pleckstrin homology (PH) domain of TFIIH subunit p62/Tfb1.
  • Structure:2RVB; human XPC acidic region binds to the pleckstrin homology (PH) domain of TFIIH subunit p62, contacts at 4A
    View structure with Cn3D
  • Structure:2M14: Saccharomyces cerevisiae Rad4 acidic region binds to the PH domain of Tfb1; contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ##        ######## ##########              
2RVB_A          9 KRGATMNEDSNEEEEESENDWEEVEELSEPVl-GDVRESTAFS 50   human
2M14_B          2 STDDSVEEIQSSEEDYDSEEFEDVTDGNEVA--GVEDISVEIK 42   Saccharomyces cerevisiae S288C
XP_014447971  112 SKREATVDKGSSEDEDSEGDWEEVEELNEPMl-GDAGESAAPS 153  Chinese tree shrew
EHH21014      113 KKGATMNEDSNEEEEESEDDWEEVEELSEPVl-GDVRESTAFS 154  Macaca mulatta
ACE74253       78 KRGATMNEDSNEEEEESENDWEEVEELSEPVl-GDVRESTAFS 119  Homo sapiens
NP_001038675   92 DTSLSKQVKEEEEDSEDEDDWEEVEEMAGPL--GPVDSSELAL 132  Danio rerio
NP_476861      19 EWKPSKDVKGGESSDDDDSDFDELQAEGGAA--GSSGRSSAVA 59   Drosophila melanogaster
NP_500156     263 KREKSFKISESESSSESPDDESEASEASEDP--SIPGPSEPRK 303  Caenorhabditis elegans
NP_587828      83 GSDEDNEKLGSSEDDEFDDDFDTWEQVDLSPn-KQEDKKDLHI 124  Schizosaccharomyces pombe
XP_015496538  625 SRVDPEWWEETLQPYESPNVERDKKEENEFQv-KLQDQPLPTA 666  Parus major
XP_004914219  225 KGATVKESSESEEAEDSDEEWEDVEELNGSVldDLQASTSADI 267  Xenopus tropicalis
Q01831        113 KRGATMNEDSNEEEEESENDWEEVEELSEPVl-GDVRESTAFS 154  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap