2ZB4,2W4Q,2ZB3,1VJ1,2ZB7


Conserved Protein Domain Family
PTGR2

?
cd08293: PTGR2 
Click on image for an interactive view with Cn3D
Prostaglandin reductase
Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Statistics
?
PSSM-Id: 176253
View PSSM: cd08293
Aligned: 13 rows
Threshold Bit Score: 582.425
Threshold Setting Gi: 156386361
Created: 15-Jan-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
NADP bindingsubstrate
Conserved site includes 25 residues -Click on image for an interactive view with Cn3D
Feature 1:NADP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                           #                            
2ZB4_A         7 MIVQRVVLNSRPGKNGnPVAENFRMEEVyLPDNIn--EGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWq---lSQVVD 81  human
2W4Q_A         2 MIVQRVVLNSRPGKNGnPVAENFRMEEVyLPDNIn--EGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWq---lSQVVD 76  human
2ZB3_A         3 MIIQRVVLNSRPGKNGnTVAENFRVEEFsLPDALn--EGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWq---lAQVAD 77  house mouse
1VJ1_A        13 XIIQRVVLNSRPGKNGnPVAENFRVEEFsLLDALn--EGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWq---lAQVAD 87  house mouse
2ZB7_A         7 MIVQRVVLNSRPGKNGnPVAENFRMEEVyLPDNIn--EGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWq---lSQVVD 81  human
AAH77125      40 LNVTRVVLSSRPGNNGqPVKENFRVEETtTSSELk--EGQVLVRTLYLSVDPYMRCRMNDDTGADYLLPWr---lEECVD 114 zebrafish
NP_001026366   1 MIIQRVVLNSRPGKNGvPVAENFRLEQStIPDTVq--EGQVRVRTLYLSVDPYMRCRMNEDTGSDYLLPWq---lSEVAD 75  chicken
XP_783631     13 KMNKRVVLASRPGINTtPTVDHFEVEECpVPEIK---DGTIIVKTLCLSVDPYMRCRMNLDTGTDYMSPWr---lHQTID 86  purple urchin
NP_001076629  22 ADNKVVIFVKRPGENNaPTIDCFDVVPIdSPSEKditSDQCIVRTLFLSVDPAQRCRMNPSTGVDYLGPYeigepVDGME 101 nematode
NP_001088954   1 MKIKRVVLASRPGNDRePVKENFRLEELtISEELt--EGKVLARTLFLSVDPYLRCRMNEDTGTDYIGPWk---iSEVLD 75  African clawed ...
XP_001633881   4 KQNSRVILRSRPGKVNpPSLENFAVEPV-EPPLVc-eQGEILVKTLYLSVDPYMRSRMNEGGSVGYIAPFe---iGKVLS 78  starlet sea ane...
XP_001892599  19 SYNKRIVFVRRPGANNfPSADCFRCEDClAPNRLdvgNGQCIVRTLFLSVDPAQRCRMNKSTGVDYLAPYeigelVDGLE 98  agent of lympha...
XP_002597225   2 STNRRVVLASRPGVNGePRVENFCTEDCgYPVVH---DGQILAKTLFLSVDPYMRCRMNEDTGAQYLSPWq---lDHACE 75  Florida lancelet
Feature 1                                                                            #           
2ZB4_A        82 GGGIGIIEESKhTNLTKGDFVTSFY--WPWQTKVIL--DGNSLEKVDPq-LVDGHLSYFLGAIGMPGLTSLIGIQEKGHI 156 human
2W4Q_A        77 GGGIGIIEESKhTNLTKGDFVTSFY--WPWQTKVIL--DGNSLEKVDPq-LVDGHLSYFLGAIGMPGLTSLIGIQEKGHI 151 human
2ZB3_A        78 GGGIGVVEESKhQKLTKGDFVTSFY--WPWQTKAIL--DGNGLEKVDPq-LVDGHLSYFLGAIGMPGLTSLIGVQEKGHI 152 house mouse
1VJ1_A        88 GGGIGIVEESKhQKLAKGDFVTSFY--WPWQTKAIL--DGNGLEKVDPq-LVDGHLSYFLGAIGXPGLTSLIGVQEKGHI 162 house mouse
2ZB7_A        82 GGGIGIIEESKhTNLTKGDFVTSFY--WPWQTKVIL--DGNSLEKVDPq-LVDGHLSYFLGAIGMPGLTSLIGIQEKGHI 156 human
AAH77125     115 GGGVGVVKASKnPDLSVGTIVTSFN--WHWQTYDVM--DGSLLQKVDPg-MVDGHVSYFLGAVGMPGLTAFFGVREKGHV 189 zebrafish
NP_001026366  76 GGGIGVVEESKhHNFAKGDIVTSFN--WPWQTVAIL--DGSLLQKVVPe-LVNGRLSYFLGAAGLTGLTALLGIREKGHV 150 chicken
XP_783631     87 GGGVGIIVESQcRGFRRGEILESFH--WPWQVYALM--DKQEKEEVDPa-LIERHFSLICGLFGLPGQAAYIGIREKGHV 161 purple urchin
NP_001076629 102 GVGVVERVGSA-CTLEVGDLVTGCIrlWTWTKYFVC--DSSDLVKVNLpsSRNFSPSVILSCAGLSGITALLGIRKKALI 178 nematode
NP_001088954  76 SGGIGVVEESRtSKFAAGDFITSFN--WPWQTKSIL--NGESLIKLDPs-LVDGHLSHFLGAVGLTGLTALIGVKEKGHV 150 African clawed ...
XP_001633881  79 GGGVGRVEESKsDKFSVGDIVECFG--FPWQHYCVLpeDHQSLRKVESe-IVCENPSLALGLCGLTALTSLIALQERGHI 155 starlet sea ane...
XP_001892599  99 GIGVIEMVSSN-SAFKVGDLVTSIGrlWPWSRLFVA--DEVDLVRVTL--PPGFSPSIILSCVGLSGLTALLGIQKKAEI 173 agent of lympha...
XP_002597225  76 GGGVGVVIDSKhQDFHAGDIVETFN--LPWQQYSLL--SPDGLRKLDPt-LLGGKLSLALGAVGMPGATSLLGIREKGHV 150 Florida lancelet
Feature 1                      ###                                             ##   #            
2ZB4_A       157 TAGSNKTMVVSGAAGACGSVAGQIGHF--------------------------LGCSRVVGICGTHEKCILLTSeLGFDA 210 human
2W4Q_A       152 TAGSNKTMVVSGAAGACGSVAGQIGHF--------------------------LGCSRVVGICGTHEKCILLTSeLGFDA 205 human
2ZB3_A       153 SAGSNQTMVVSGAAGACGSLAGQIGHL--------------------------LGCSRVVGICGTQEKCLFLTSeLGFDA 206 house mouse
1VJ1_A       163 SAGSNQTXVVSGAAGACGSLAGQIGHL--------------------------LGCSRVVGICGTQEKCLFLTSeLGFDA 216 house mouse
2ZB7_A       157 TAGSNKTMVVSGAAGACGSVAGQIGHF--------------------------LGCSRVVGICGTHEKCILLTSeLGFDA 210 human
AAH77125     190 TAGAQQTMVVSGAAGACGSVAGQIGRL--------------------------DGCKTVVGICGSDQKCQTLVKeLGFTA 243 zebrafish
NP_001026366 151 TVGANQTMVVSGAAGACGSLAGQIGRL--------------------------EGCSRVVGIAGTDEKCSILVSeMGFDA 204 chicken
XP_783631    162 IPEASQSFVVSAAAGACGSLAGQIARL--------------------------QGCSPVVGICGSDTKCSFLQEeLSFHH 215 purple urchin
NP_001076629 179 DRSRPQTIVVSGAAGSCGSLAGQIARI--------------------------EGCSKVIGICGSDDKCTVLKReFGFND 232 nematode
NP_001088954 151 IPGANQTMVVSGAAGACGSLAGQIGRL--------------------------LGCSRIVGICGTEQKCKLLVSdLGFDS 204 African clawed ...
XP_001633881 156 VPGQNQTVVVTGAAGACGSAAGQIAKI--------------------------FGCGKLVGICGSEEKCQYIKE-LGFDS 208 starlet sea ane...
XP_001892599 174 DRTRPQTFVVSGAAGSCGSLAGQRLIFvyfrmakncaigtecvamdivliarlHGCTKVIGICGSDQKCAVLLNeWGFNG 253 agent of lympha...
XP_002597225 151 TPGANQTFVVSGAAGACGSLAGQIARL--------------------------EGAAHVVGICGSEEKCKLLKEeFGFDH 204 Florida lancelet
Feature 1           #                       ##                    ##### #                        
2ZB4_A       211 AINYKK-DNVAEQLREsCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSpAIEAIQKERNIT 289 human
2W4Q_A       206 AINYKK-DNVAEQLREsCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSpAIEAIQKERNIT 284 human
2ZB3_A       207 AVNYKT-GNVAEQLREaCPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPpAVEAIRKERNIT 285 house mouse
1VJ1_A       217 AVNYKT-GNVAEQLREaCPGGVDVYFDNVGGDISNTVISQXNENSHIILCGQISQYNKDVPYPPPLPpAVEAIRKERNIT 295 house mouse
2ZB7_A       211 AINYKK-DNVAEQLREsCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSpAIEAIQKERNIT 289 human
AAH77125     244 GINYRN-GDVSSALREhCPRGIDIYFDNVGGPISDAVISQMNPGAHVILCGQISQYNKDVPYPPPLSqDTQDALRRNNIT 322 zebrafish
NP_001026366 205 AINYKT-GNVAQQLRElCPGGVDVYFDNVGGDISDTVISQMNQNSHIILCGQISQYNKDVPYPPPLPpGTEKIQKERNIT 283 chicken
XP_783631    216 AINYRT-QDVFLRIKEcCPEGVDIYFDNVGGDISNSVIKQMNENSHIILCGQISMYNTNVPYPPSLPeEIEQIREERNIT 294 purple urchin
NP_001076629 233 TINYKT-ENVSERLGHlAPEGIDIYWDNVGGVISDDVIRAMNNEGRVVLCGQIAVYNTDLPYPPPLPeHTTKIIKERNIQ 311 nematode
NP_001088954 205 AVNYKE-RGLAEKLRAcCPNGVDVYFDNVGGEISDTVVCQMNQNSHIILCGQISQYNKDVPYPPPLQaETATFLKQNNIT 283 African clawed ...
XP_001633881 209 SINYKQvDNMAEELRKhCPQGIDVYFDNVGGEISNEIIRLMNKNSHVIICGQISTYNQDIPYPNPLPqDVQEIVTKQNIT 288 starlet sea ane...
XP_001892599 254 AINYKR-ESVVDRLHKlAPEGVDIYFDNVGGFVSDAVISLMSEGGRIVLCGQIAVYNTDLPNPPPLPeKTAQIIAERKIK 332 agent of lympha...
XP_002597225 205 AINYRT-DNVADRLKEtCPCGIDTYFDNVGGEISETVIKQMNEGSHVILCGQISVYNKDVPYPPPIPqVVTDILKDRNIT 283 Florida lancelet
Feature 1           ###                                          ## # # #      
2ZB4_A       290 RERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCI 351 human
2W4Q_A       285 RERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCI 346 human
2ZB3_A       286 RERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCI 347 house mouse
1VJ1_A       296 RERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETVAKGLENXGVAFQSXXTGGNVGKQIVCI 357 house mouse
2ZB7_A       290 RERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCI 351 human
AAH77125     323 RERFIVLNYMEKHAEGLMQLSHWVKTGQIKVLETVVNGIQNMGEAFCSMMTGGNIGKQVVKI 384 zebrafish
NP_001026366 284 RERFLVLNYMDKQEASILQLCQWIQEGKLKVRETVVEGLANIGAAFQSMMNGGNIGKQIVLV 345 chicken
XP_783631    295 RDRFLVLNYVEEFPAAIAQLAAWWKEGKLKYKETVTHGLENAPLAFVSMMNGGNIGKQIIHV 356 purple urchin
NP_001076629 312 RERYLVLMYKDEIDEAVAQLSEWLQQDKIKVKETIYDGLNAAPSAFVDMMNGKNIGKMLIRP 373 nematode
NP_001088954 284 RERFMVLNYADQHESAIVQLSHWIKTGKLKVKETILHGLENTASAFLSMMAGGNVGKQIVQV 345 African clawed frog
XP_001633881 289 RERFLVLDFSPLIPAARAQLEVWVKEGKLKNRETVEEGLENVAKAFLSMMSGGNIGKQVVKV 350 starlet sea anemone
XP_001892599 333 REKFIVLQYKDDIDTSVAQLSAWLQEKKLKSRETVYEGLERAPEAVIDLLNGCNIGKMIVKV 394 agent of lymphatic filariasis
XP_002597225 284 RERFLVLYYQDKFQESLIQLATWVHEGRLKVKETMMEGIEKTGEAFVSLMKGGNVGKMIVHV 345 Florida lancelet

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap