1B4U


Conserved Protein Domain Family
PCA_45_Doxase_A

?
cd07924: PCA_45_Doxase_A 
Click on image for an interactive view with Cn3D
The A subunit of Protocatechuate 4,5-dioxygenase (LigAB) is the smaller, non-catalytic subunit
The A subunit is the non-catalytic subunit of Protocatechuate (PCA) 4,5-dioxygenase (LigAB), which is composed of A and B subunits that form a tetramer. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As a member of the Class III extradiol dioxygenase family, LigAB uses a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.
Statistics
?
PSSM-Id: 153394
View PSSM: cd07924
Aligned: 12 rows
Threshold Bit Score: 204.934
Threshold Setting Gi: 123118648
Created: 21-Apr-2009
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interfaceactive sitetetramer
Conserved site includes 43 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:1B4U; Interface between subunits A (1B4U_A) and B (1B4U_B) of Sphingomonas paucimobilis LigAB heterodimer; contacts at 4A.
    View structure with Cn3D
  • Comment:The active site is located at the intersubunit interface. Most active site residues are from the B subunit.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          ## ########    #   #   #  #  #    #                             #  #    ####  
1B4U_A        14 LAEFDDIPGTRVFTAQRARKGYNLNQFAMSLMKAENRERFKADESAYLDEWNLTPAAKAAVLARDYNAMIDEGGNVYFLS 93  Sphingomonas pa...
A0AWP0         4 DKPYKDVPGTTIFDADQARKGYNLNQFCMSLMKPENRERYLADRGAYLDEWPLNPVQRQAVLDIDLNTCIAEGGNIYFLA 83  Arthrobacter sp...
Q5G1K3         4 EKPYLDVPGTIIFDAEQSRKGYWLNQFCMSLMKAENRDRFRANERAYLDEWAMTEEQKQAVLARDLNWCMRTGGNIYFLA 83  Comamonas sp. D...
Q15P02         4 DKPYQKIPGTTVFDAEMGRRGYHLNQFCMSLMKAENRALFKADERAYLDKWDMTEEQKQGVLSRDYNRMMASGGNIYFLA 83  Pseudoalteromon...
Q1YUH0         9 KAAFGDIPGTLVFTAERARKGYWLNQFCMSLMKPENRKRWLANEQDYLRDWKITAEQKAALLARDYNQLLALGGNIYYLA 88  marine gamma pr...
YP_001339379   5 NKPYSDIPGTTVFDGDMARIGFHLNQFCMSLMQESNRTAFKQNERAYLDKWPMTEAQKKAVIARDFSQLIALGGNIYYLV 84  Marinomonas sp....
NP_950035      4 DKPYKDVPGTTIFDADMSRQGYHLNQFCMSLMKAENRARFKADERAYLDEWPMTEEQKQAVLDRDLNRCIALGGNIYFLA 83  Rhodopseudomona...
ZP_01115429    2 NREYDDIPGTYVMDSKHCRAGYHLNMFCMSLNKAENREAFKADEAAYLDKFSMTLEQKQAVLDRDWLGMLQLGGNIYYTF 81  Reinekea sp. ME...
YP_001859411   6 ERDYDDIPGTYVFDGERCRKGFALNMFCKSLDLAANRESFRQNPDAYLSRFALSVEQRNAVVARNWLEMLRLGGNIYYTF 85  Burkholderia ph...
Q4JML6         3 SRDYDDVPGTYVLDSRSYRKGYHLNMFCMSLNKAECREEFARDEMAYLQKFPMMEEQRQAVLDRDYIRLLQLGANVYYTF 82  uncultured bact...
ZP_05126312    4 PREFDDIPGTYVFDGQRNREGYHLNMFCKSLDIQSNRDAFRASPEEYLSKYPMSDEQRRCVLERDFLGMLRVGGNIYYTW 83  gamma proteobac...
ZP_01011786    5 PKEYDDIPGTFVFDADRSRQGYWLNQFCISLSKEENRQAFRDDPEAHMAKFKMTEDQKQAIRDRDWNRLLELGGNIYYTS 84  Rhodobacterales...
Feature 1        #  #  ## ##  #  ##      #     ########  ###
1B4U_A        94 KLFSTDGKSFQFAAGSMTGMTQEEYA--QMMIDGGRSPAGVRS 134 Sphingomonas paucimobilis
A0AWP0        84 KIGATHGLSFQQMAGSMTGMSEAAYR--DMMIGGGRRPEGNRL 124 Arthrobacter sp. FB24
Q5G1K3        84 KIGATDGKSFQQMAGSMTGMTEDEYR--AMMMGGGRSAEGNRY 124 Comamonas sp. DJ-12
Q15P02        84 KIFSSDGLSFQFAAATMTGMSQPDYA--QMMLDGGRAPEGNMF 124 Pseudoalteromonas atlantica T6c
Q1YUH0        89 KVFSTDGLSFVQAVSTMTGMTVEDYQ--AMMAAGGRSPDGVRS 129 marine gamma proteobacterium HTCC2207
YP_001339379  85 KISSSDGLSVAAAVSTMTNLSVDEYI--DMMRRGGRSPEGNRY 125 Marinomonas sp. MWYL1
NP_950035     84 KIGATDGKSFQQMAGSMTGMTEEEYR--NMMVGGGRPIEGNRY 124 Rhodopseudomonas palustris CGA009
ZP_01115429   82 KIAAFDGRSMQYVGGKMSGVSEEEFR--QMMVSGGRSVEGNRS 122 Reinekea sp. MED297
YP_001859411  86 KLAIFDGLTMQHVGAAMSAKPMSVDEfrTMMVSGGRPIAGNRS 128 Burkholderia phymatum STM815
Q4JML6        83 KIVSHDRQPPQVMYGKMSSPPMTFDEfqEMMINGGRPIDGNRS 125 uncultured bacterium BAC17H8
ZP_05126312   84 KIAAFDRVSMQAAGAAMSGTGMTEDEfkQMMMEGGRSIEGNRS 126 gamma proteobacterium NOR5-3
ZP_01011786   85 KLGAFDGIVFQDLAAMMSGMSRDDYR--KMMVDGGRSPDGNRY 125 Rhodobacterales bacterium HTCC2654

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap