Conserved Protein Domain Family
AthCS_per_like

?
cd06115: AthCS_per_like 
Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains three Arabidopsis peroxisomal CS proteins, CYS1, -2, and -3 which are involved in the glyoxylate cycle. AthCYS1, in addition to a peroxisomal targeting sequence, has a predicted secretory signal peptide; it may be targeted to both the secretory pathway and the peroxisomes and is thought to be located in the extracellular matrix. AthCSY1 is expressed only in siliques and specifically in developing seeds. AthCSY2 and 3 are active during seed germination and seedling development and are thought to participate in the beta-oxidation of fatty acids.
Statistics
?
PSSM-Id: 99868
View PSSM: cd06115
Aligned: 7 rows
Threshold Bit Score: 745.802
Threshold Setting Gi: 46110941
Created: 9-Nov-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                               #                                        
NP_191434     71 EHGTVKavDLKKITTGkd--------dkGLKLY--DPGYLNTAPVRSSICYIDGDeGILRYRGYPIEELAESStFIEVAY 140 thale cress
Q9SJH7        66 DDGTVKavDFKKIVTGke--------dkGLKLY--DPGYLNTAPVRSSISYIDGDeGILRYRGYPIEEMAENStFLEVAY 135 thale cress
XP_001753753  59 EGGTVKatDFKKITAGed--------gnGLRLF--DPGYLNTAPVRSKISYIDGDkGILRYRGYPIEELAEKSsFTEVAF 128 Physcomitrella ...
XP_642824     36 HETVKSi-DFRAIKEQsi--------dfGTMIY--DPGYYNTAVCKSQITYIDGDrGILEYRGYPIEQLAEKSsFLEVSY 104 Dictyostelium d...
BAD05063      39 NSREGRyiMAKDIGKIkd--------aeGNVLRvyDPGYMNTIVNTSRICYIDGDlGVLEYRGIPIEQLAEKStFLEVAY 110 Tetrahymena the...
EDP01358      55 DGGTINaqALKQIKAGgd--------gvGLRTY--DPGYTNTTAVISRISFIDGDkGILRYRGYPIEELAARSnMMEVAY 124 Chlamydomonas r...
XP_382528     29 THNSIPatEFKKIKAEagndrpedetnqGLRVY--DPAYMNTAVVQSKITYINGLdGVLRYRGYPIEQLVEKSdFLESAY 106 Gibberella zeae...
Feature 1                                                                                        
NP_191434    141 LLMYGNLPSQSQLADWEFTVSQHsaVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALSGQDIYKsk------ 214 thale cress
Q9SJH7       136 LLMYGNLPSESQLSDWEFAVSQHsaVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALRGQDIYDsk------ 209 thale cress
XP_001753753 129 LLMYGNLPTKSQLADWEASISQHsaVPEGVLEVLAALPHDAHPMGMLVGSICALSSFHPDANPALQGQDLYKnk------ 202 Physcomitrella ...
XP_642824    105 LLIYGDLPSKEQSNLWNTKIMNHtfIHENLISMMKSFRYDAHPMGMLISSLSAMSTFYPEANPALAGVDIYKnk------ 178 Dictyostelium d...
BAD05063     111 LLIYGELPTKTQFEEFNQRISGHtfLHTDVLQMMKHFRYDAHPMGMLISTIAALSTFRPGSNPALAGQDIYKdl------ 184 Tetrahymena the...
EDP01358     125 LVLYGSLPTQSQLSVFHEAVMRHtaLPTEVIDVIHAMPHDSHPMGVLMTGICALSAMHPEANPALAGQGVYKtr------ 198 Chlamydomonas r...
XP_382528    107 LLIYGELPTKSEYDLWHGEVMHHtyIHSDIENMFKSFRYDSHPMSMLTAAFATLGAFAPEANPSLAGQKLYTnaasgnle 186 Gibberella zeae...
Feature 1                                                                                    #  #
NP_191434    215 --qVRDKQIVRILGKAPTIAAAAYLRTAGRPPVLPSANLSYSENFLYMLDsmgnrsYKPNPRLARVLDILFILHAEHEMN 292 thale cress
Q9SJH7       210 --qVRDKQIIRIIGKAPTIAAAAYLRMAGRPPVLPSGNLPYADNFLYMLDslgnrsYKPNPRLARVLDILFILHAEHEMN 287 thale cress
XP_001753753 203 --aVRDKQIVRVLGKVPTLAAAAYLRMAGRPPVLPSNQLSYAENFLYMLDslgdrkYKPNPRLARVLDILFILHAEHEMN 280 Physcomitrella ...
XP_642824    179 --qLMNKQIFRILGKLPTIAACAYRHRIGRPYNDPSNTLSYTENFLYMLDrlsesnYKPHPVLTRALDKLFIIHADHELN 256 Dictyostelium d...
BAD05063     185 --kIRNKQIYRILGQVPTIAANAYRSRIGRNFNNPSSDLPYVDNFLYMMDklnenkYSPHPKLAKALDILFILHAEHEMN 262 Tetrahymena the...
EDP01358     199 --eMQDKQIVRLLGKIPTIAAMAYHKSTGRKAAPPNQRLDYTENFLYMLDggynpqYRPNPRLARALDIMFLLHAEHEMN 276 Chlamydomonas r...
XP_382528    187 alqMLDKQILRILGKAPTLAAASYRMRQGRPFNRPAQDLGYTGNFLYLLDhlsetdYKPHPVLARALDKLFIIHADHEVN 266 Gibberella zeae...
Feature 1                                      ### #  #                           ########  #    
NP_191434    293 CSTAAARHLASSGVDVYTACAGAVGALYGPLHGGANEAVLKMLAEIGTAENIPDFIEGVKNRKR-KMSGFGHRVYKNYDP 371 thale cress
Q9SJH7       288 CSTAAARHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLKMLSEIGTVENIPEFIEGVKNRKR-KMSGFGHRVYKNYDP 366 thale cress
XP_001753753 281 CSTAAARHLASSGVDVYTALAGATGALYGPLHGGANEAVLKMLAEIGTVENIPDFLEGVKNSRKrKMSGFGHRVYKNYDP 360 Physcomitrella ...
XP_642824    257 CSTATMRQIASTLVDPYTACAGSAGALYGPLHGGANEAVLRMLEAIGTIENIPKFIEQVKQKKQ-RLMGFGHRVYKSYDP 335 Dictyostelium d...
BAD05063     263 CSTAFVRHLASSGVDVYSCIAGSAAALYGPKHGGANEAVLRMLEQIGDVKNIPSFIDKVKNRKA-LLFGFGHRVYKNYDP 341 Tetrahymena the...
EDP01358     277 CSTAAVRHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLRMLARIGSVENIPAFIAGVKNKKE-KLFGFGHRVYRNFDP 355 Chlamydomonas r...
XP_382528    267 CSTATVMQVGSSLVDPYSVVAAGCAALYGPSHGGASESAIRMLIEIGSPENVPAFMQAVEKRER-VLVGFGHRVYKNVDP 345 Gibberella zeae...
Feature 1        #                                        # #  # #                    #   #      
NP_191434    372 RAKVIKKLADEVFs-IVGRdPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGfppeFFTVLFAVPRMAGYLS 450 thale cress
Q9SJH7       367 RAKVIKNLADEVFs-IVGKdPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGfppeFFTVLFAIPRMAGYLS 445 thale cress
XP_001753753 361 RAKVVRTLADEVFk-IVGRdPLIEVAVALEKAALADEYFVKRKLYPNVDFYSGVIYRALGfpteFFPVLFAIPRMAGYLA 439 Physcomitrella ...
XP_642824    336 RAKILKTVTMEIFa-LLGKnPLMQIATELERLALSDSYFIERQLYPNVDFYSGIIYKSMGfptdMFPVLFSIPRAAGWLA 414 Dictyostelium d...
BAD05063     342 RAKIVKKTAYEVFe-ICGKePLIEIAIELEKIALEDEFFIKRKLYPNVDFYSGVIYRAMGfptdMFPVLFTIPRVAGWLA 420 Tetrahymena the...
EDP01358     356 RAKIIKDVAENEVfpLVGVdPLIEIAKALQDAALSDEYFVSRKLYPNVDFYSGLVYRALGfppqFFTVLFAIPRIVGYCA 435 Chlamydomonas r...
XP_382528    346 RSTAIRKLAEEVFe-VTGRnKLLDTALTLADYARKSEFMRSRNLYPNVDFYSGLIYQAMGfpldFYPVLFAVPRCVGWLA 424 Gibberella zeae...
Feature 1                    #  #               
NP_191434    451 HWRESLDDp-dTRIMRPQQAYTGvWMRHYEP 480 thale cress
Q9SJH7       446 HWKESLDDp-dTKIMRPQQVYTGvWLRHYTP 475 thale cress
XP_001753753 440 HWKESLDDp-dTKIMRPQQWYQGeWLRHYTP 469 Physcomitrella patens subsp. patens
XP_642824    415 HWVEELADp-eLRIFRPRQIYMGrRNMNYVP 444 Dictyostelium discoideum AX4
BAD05063     421 HWVEYLDDk-eNNIVRPRQNYVGyAKRDYVP 450 Tetrahymena thermophila
EDP01358     436 HWRESLTDp-dTKIIRPQQDYKGvWLRHYSD 465 Chlamydomonas reinhardtii
XP_382528    425 HWRQMMLNsagVKIWRPRQLYIGeGEREYVE 455 Gibberella zeae PH-1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap