4JJH


Conserved Protein Domain Family
IgV_1_Nectin-4_like

?
cd05888: IgV_1_Nectin-4_like 
First immunoglobulin (Ig) domain of nectin-4, and similar domains
The members here are composed of the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4 or LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult tissue or in serum. Nectin-4 is re-expressed in breast carcinoma, and patients having metastatic breast cancer have a circulating form of nectin-4 formed from the ectodomain
Statistics
?
PSSM-Id: 409471
View PSSM: cd05888
Aligned: 4 rows
Threshold Bit Score: 183.947
Threshold Setting Gi: 189521116
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 61 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Comment:Based on similarity to human poliovirus receptor (CD155).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             ########         #########       #############                    ######
4JJH_A     12 DVVTVVlgQDAKLPCFYRGdsg-eqVGQVAWARVdagegaQELALLHSKYGLHVSPa-YEGRVEQPPPprnplDGSVLLR 89  human
AAH89234   68 KSMTAVlgTDVTMPCYYQAeag-ekVAQVVWLKKgangqnMEIALLNTEYGANIFGa-YEGRIKEKAPld-paDGGIVLR 144 western clawed frog
XP_689011  38 DLWSLAe-GETRLPCRFNVsdseitVVQVLWIREnng-veEQILTAHFKEGQTEFHssYSGRVRFETNnp-iaDSALIIM 114 zebrafish
AAF82399   38 DVVTVVlgQDAKLPCFYRGdsg-eqVGQVAWARVdagegaQELALLHSKYGLHVSPa-YEGRVEQPPPprnplDGSVLLR 115 human
Feature 1     #    ###############  #########
4JJH_A     90 NAVQADEGEYECRVSTFPAGSFQARLRLRVL 120 human
AAH89234  145 NAVQPDEGTYLCRVNTFPAGNFDAELELKVL 175 western clawed frog
XP_689011 115 RTLSADEGKYKCKIITFPSGNFEAEIVLTVW 145 zebrafish
AAF82399  116 NAVQADEGEYECRVSTFPAGSFQARLRLRVM 146 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap