4U7M


Conserved Protein Domain Family
IgI_LRIG1-like

?
cd05763: IgI_LRIG1-like 
Immunoglobulin (Ig)-like ectodomain of the LRIG1 (Leucine-rich Repeats And Immunoglobulin-like Domains Protein 1) and similar proteins; member of the I-set of IgSF domains
The members here are composed of subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond. The ectodomain of LRIG1 has two distinct regions: the proposed 15 LRRs and three Ig-like domains closer to the membrane. LRIG1 has been reported to interact with many receptor tyrosine kinases, GDNF/c-Ret, E-cadherin, JAK/STAT, c-Met, and the EGFR family signaling systems. Immunoglobulin Superfamily (IgSF) domains can be divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets. The structure of the LRIG1 extracellular Ig domain lacks a C" strand and thus is better described as a member of the I-set of IgSF domains.
Statistics
?
PSSM-Id: 409420
View PSSM: cd05763
Aligned: 7 rows
Threshold Bit Score: 183.204
Threshold Setting Gi: 115666689
Created: 11-Jul-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ####                                                                            
4U7M_A        107 SFTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAG 186  human
CAF87524       57 SFIKTPRDSTIRTGHTARLECAAEGHPAPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIMDVKPEDMGLYSCTARNTAG 136  Tetraodon nig...
P70193        602 SFTKIPHDIAIRTGTTARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDMGVYSCTAQNSAG 681  house mouse
XP_001187660  575 SFTVTPRHVSVRVGGIAELPCAATGHPTPKIAWQKDGGINFPAARQRRIKVKTELAEFYIDNVQISDTGVYTCTALNAAG 654  purple urchin
XP_416055     583 SFTKIPMDLTIRAGAMARLECAAVGHPVPQIAWQKDGGTDFPAARKRRMHVMPEDDVFFIVDVKIEDTGVYSCTAQNTAG 662  chicken
XP_001121890  582 SFSKIPHDIRVIAGSTARLECSAEGQPSPQIAWQKDGGNDFPAARERRMHMMPTDDVLFIVDVKTADSGVYSCTAQNLAG 661  honey bee
AAI30122      637 LFTKKPMDLTIRAGSTARLECAAVGHPTPQIAWQKNGGTDFPAARERRMHVMPEDDVFFIVNVKTEDIGVYSCTAQNSAG 716  African clawe...
Feature 1                    
4U7M_A        187 SISANATLTVL 197  human
CAF87524      137 TVSANATLTVL 147  Tetraodon nigroviridis
P70193        682 SVSANATLTVL 692  house mouse
XP_001187660  655 TISTNATLTVL 665  purple urchin
XP_416055     663 SISANATLTVL 673  chicken
XP_001121890  662 LIVANATLTIL 672  honey bee
AAI30122      717 SISANATLTVL 727  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap